DLK-1/Pref-1 recombinant protein

Human DLK-1/Pref-1

Cat. Num. AAA692217

• Gene Names: DLK1; DLK; FA1; ZOG; pG2; DLK-1; PREF1; Delta1; Pref-1
• Reactivity: Human
• Purity: > 98 by SDS-PAGE & visualized by silver stain
• Synonyms: DLK-1/Pref-1; Human DLK-1/Pref-1; Protein delta homolog 1; pG2; Fetal antigen 1; FA1; ZOG; DLK-1/Pref-1 recombinant protein

• Host: E Coli
• Reactivity: Human
• Purity/Purification: > 98 by SDS-PAGE & visualized by silver stain
• Form/Format: Lyophilized
• Sequence: N-Terminal Sequence: AECFP; Protein Sequence: AECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGEPGQ CICTDGWDGELCDRDVRACSSAPCANNGTCVSLDDGLYECSCAPGYSGKD CQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANS CTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTC LQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVH ELPVQQPEHRILKVSMKELNKKTPLEHHHHHH
• Sequence Length: 383

• Species: Human
• Conjugation: His-Tag

Related Product Information for DLK-1/Pref-1 recombinant protein

Delta-like 1 (DLK1), also known as Pref-1 and FA1, is a transmembrane protein pertaining to the epidermal growth factor superfamily. DLK1 affects several differentiation processes, including adipogenesis, muscular and neuronal differentiation, bone differentiation, and haematopoiesis. Several reports support that DLK1 may operate as a non-canonical ligand of the NOTCH pathway. Since the NOTCH signaling pathway is essential for vascular development and physiology by controlling angiogenesis in pre- and post-natal life, it was reasoned that DLK1 could contribute to regulate this process in adult endothelial cells through the interaction with NOTCH receptors. It was found that overexpression of DLK1 inhibits migration and angiotube formation in mammalian vascular endothelial cells and disrupts normal embryonic vascularization in zebrafish. Genetic ablation of DLK1 in mice is associated with increased angiogenesis in vitro and with focal areas of retinal hyper-vascularization. Specific knockdown of the orthologous Dlk1 of zebrafish results in ectopic angiogenesis. Moreover, in a tumor angiogenesis model in zebrafish, suppression of Dlk1 promotes vessel migration towards the tumor cell mass. It was also found that the NOTCH signaling pathway is targeted by DLK1 in the context of angiogenesis and that DLK1 antagonizes NOTCH-dependent signaling in endothelial cells, while, in contrast, this signaling is enhanced in Dlk1-null mice. Collectively, these results revealed a previously unknown role for DLK1 in the vasculature as a regulator of NOTCH-mediated angiogenesis.

Product Categories/Family for DLK-1/Pref-1 recombinant protein

Recombinant protein; Cytokines & Growth Factors; DLK-1/Pref-1

NCBI and Uniprot Product Information

• NCBI GI #: 74136023
• NCBI GeneID: 8788
• NCBI Accession #: NP_003827.3
• NCBI GenBank Nucleotide #: NM_003836.5
• UniProt Accession #: P80370; P15803; Q96DW5
• Molecular Weight: 33,067 Da
• NCBI Official Full Name: protein delta homolog 1
• NCBI Official Synonym Full Names: delta-like 1 homolog (Drosophila)
• NCBI Official Symbol: DLK1
• NCBI Official Synonym Symbols: DLK; FA1; ZOG; pG2; DLK-1; PREF1; Delta1; Pref-1
• NCBI Protein Information: protein delta homolog 1; secredeltin; fetal antigen 1; preadipocyte factor 1
• UniProt Protein Name: Protein delta homolog 1
• UniProt Gene Name: DLK1
• UniProt Synonym Gene Names: DLK; DLK-1; FA1
• UniProt Entry Name: DLK1_HUMAN

NCBI Description

This gene encodes a transmembrane protein containing six epidermal growth factor repeats. The protein is involved in the differentiation of several cell types, including adipocytes; it is also thought to be a tumor suppressor. It is one of several imprinted genes located in a region of on chr 14q32. Certain mutations in this imprinted region can cause phenotypes similar to maternal and paternal uniparental disomy of chromosome 14 (UPD14). This gene is expressed from the paternal allele. A polymorphism within this gene has been associated with child and adolescent obesity. The mode of inheritance for this polymorphism is polar overdominance; this non-Mendelian inheritance pattern was first described in sheep with the callipyge phenotype, which is characterized by muscle hypertrophy and decreased fat mass. [provided by RefSeq, Mar 2010]

Uniprot Description

DLK1: May have a role in neuroendocrine differentiation. Monomer. Found within the stromal cells in close contact to the vascular structure of placental villi, yolk sac, fetal liver, adrenal cortex and pancreas and in the beta cells of the islets of Langerhans in the adult pancreas. Found also in some forms of neuroendocrine lung tumor tissue. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 14q32

Cellular Component: extracellular space; integral to membrane; external side of plasma membrane

Biological Process: Notch signaling pathway; regulation of gene expression; embryonic skeletal development; multicellular organismal development; negative regulation of Notch signaling pathway; cell differentiation; post-embryonic development