Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Sequence Information (The original sequence contains two "U"s (red arrows) that have already been mutated to "S" in the above sequence which will be used to express the corresponding recombinant protein. Explanation The "U" selenocysteine is encoded by UGA and is normally used as a stop codon in prokaryotic cells, which will lead to early termination of translation, so we will mutate this selenocysteine; In terms of the formation of selenocysteine , selenocysteine is actually a derivative of serine. Selenocysteine and cysteine as well as serine are highly similar. This selenocysteine can be regarded as either the "S" of cysteine replaced by Se, or the "O" of serine replaced by Se, and it can mutated to be serine or cysteine. Generally, we mutate it to serine considering from protein expression (because if mutating to cysteine, additional disulfide bonds may form, thus affecting the expression and structure of the protein))

Type II iodothyronine deiodinase (DIO2) Recombinant Protein | DIO2 recombinant protein

Recombinant Human Type II iodothyronine deiodinase (DIO2) , partial

Gene Names
DIO2; D2; 5DII; SelY; DIOII; TXDI2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Type II iodothyronine deiodinase (DIO2); Recombinant Human Type II iodothyronine deiodinase (DIO2); partial; DIO2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
37-278aa (The original sequence contains two "U"s at the 133 and 266 sites that have already been mutated to "S" in the recombinant MBS7094134 protein, please refer to the sequence image and legend for details.)
Sequence
SKSTRGEWRRMLTSEGLRCVWKSFLLDAYKQVKLGEDAPNSSVVHVSSTEGGDNSGNGTQEKIAEGATCHLLDFASPERPLVVNFGSATSPPFTSQLPAFRKLVEEFSSVADFLLVYIDEAHPSDGWAIPGDSSLSFEVKKHQNQEDRCAAAQQLLERFSLPPQCRVVADRMDNNANIAYGVAFERVCIVQRQKIAYLGGKGPFSYNLQEVRHWLEKNFSKRSKKTRLAG
Sequence Length
273
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Sequence Information

(The original sequence contains two "U"s (red arrows) that have already been mutated to "S" in the above sequence which will be used to express the corresponding recombinant protein. Explanation The "U" selenocysteine is encoded by UGA and is normally used as a stop codon in prokaryotic cells, which will lead to early termination of translation, so we will mutate this selenocysteine; In terms of the formation of selenocysteine , selenocysteine is actually a derivative of serine. Selenocysteine and cysteine as well as serine are highly similar. This selenocysteine can be regarded as either the "S" of cysteine replaced by Se, or the "O" of serine replaced by Se, and it can mutated to be serine or cysteine. Generally, we mutate it to serine considering from protein expression (because if mutating to cysteine, additional disulfide bonds may form, thus affecting the expression and structure of the protein))

Sequence Information (The original sequence contains two "U"s (red arrows) that have already been mutated to "S" in the above sequence which will be used to express the corresponding recombinant protein. Explanation The "U" selenocysteine is encoded by UGA and is normally used as a stop codon in prokaryotic cells, which will lead to early termination of translation, so we will mutate this selenocysteine; In terms of the formation of selenocysteine , selenocysteine is actually a derivative of serine. Selenocysteine and cysteine as well as serine are highly similar. This selenocysteine can be regarded as either the "S" of cysteine replaced by Se, or the "O" of serine replaced by Se, and it can mutated to be serine or cysteine. Generally, we mutate it to serine considering from protein expression (because if mutating to cysteine, additional disulfide bonds may form, thus affecting the expression and structure of the protein))

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34,704 Da
NCBI Official Full Name
type II iodothyronine deiodinase isoform a
NCBI Official Synonym Full Names
iodothyronine deiodinase 2
NCBI Official Symbol
DIO2
NCBI Official Synonym Symbols
D2; 5DII; SelY; DIOII; TXDI2
NCBI Protein Information
type II iodothyronine deiodinase
UniProt Protein Name
Type II iodothyronine deiodinase
UniProt Gene Name
DIO2
UniProt Synonym Gene Names
ITDI2; TXDI2

NCBI Description

The protein encoded by this gene belongs to the iodothyronine deiodinase family. It catalyzes the conversion of prohormone thyroxine (3,5,3',5'-tetraiodothyronine, T4) to the bioactive thyroid hormone (3,5,3'-triiodothyronine, T3) by outer ring 5'-deiodination. This gene is widely expressed, including in thyroid, placenta, pituitary and brain. It is thought to be responsible for the 'local' production of T3, and thus important in influencing thyroid hormone action in these tissues. It has also been reported to be highly expressed in thyroids of patients with Graves disease, and in follicular adenomas. The intrathyroidal T4 to T3 conversion by this enzyme may contribute significantly to the relative increase in thyroidal T3 production in these patients. This protein is a selenoprotein containing the rare selenocysteine (Sec) amino acid at its active site, and may contain additional Sec residues. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, May 2016]

Uniprot Description

Responsible for the deiodination of T4 (3,5,3',5'-tetraiodothyronine) into T3 (3,5,3'-triiodothyronine). Essential for providing the brain with appropriate levels of T3 during the critical period of development.

Research Articles on DIO2

Similar Products

Product Notes

The DIO2 dio2 (Catalog #AAA7094134) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 37-278aa (The original sequence contains two "U"s at the 133 and 266 sites that have already been mutated to "S" in the recombinant MBS7094134 protein, please refer to the sequence image and legend for details.). The amino acid sequence is listed below: SKSTRGEWRR MLTSEGLRCV WKSFLLDAYK QVKLGEDAPN SSVVHVSSTE GGDNSGNGTQ EKIAEGATCH LLDFASPERP LVVNFGSATS PPFTSQLPAF RKLVEEFSSV ADFLLVYIDE AHPSDGWAIP GDSSLSFEVK KHQNQEDRCA AAQQLLERFS LPPQCRVVAD RMDNNANIAY GVAFERVCIV QRQKIAYLGG KGPFSYNLQE VRHWLEKNFS KRSKKTRLAG . It is sometimes possible for the material contained within the vial of "Type II iodothyronine deiodinase (DIO2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.