Endoribonuclease Dicer (DICER1) Recombinant Protein | DICER1 recombinant protein

Recombinant Human Endoribonuclease Dicer (DICER1) , partial

Cat. Num. AAA1439496

• Gene Names: DICER1; DCR1; MNG1; Dicer; HERNA; RMSE2; Dicer1e; K12H4.8-LIKE
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Endoribonuclease Dicer (DICER1); Recombinant Human Endoribonuclease Dicer (DICER1); partial; DICER1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1566-1922. Partial
• Sequence: LLGCYLTSCGERAAQLFLCSLGLKVLPVIKRTDREKALCPTRENFNSQQKNLSVSCAAASVASSRSSVLKDSEYGCLKIPPRCMFDHPDADKTLNHLISGFENFEKKINYRFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVQFQLEKNEMQGMDSELRRSEEDEEKEEDIEVPKAMGDIFESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLEMEPETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRSLKANQPQVPNS

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for DICER1 recombinant protein

This gene encodes a protein possessing an RNA helicase motif containing a DEXH box in its amino terminus and an RNA motif in the carboxy terminus. The encoded protein functions as a ribonuclease and is required by the RNA interference and small temporal RNA (stRNA) pathways to produce the active small RNA component that represses gene expression. Two transcript variants encoding the same protein have been identified for this gene.

NCBI and Uniprot Product Information

• NCBI GI #: 307133775
• NCBI GeneID: 23405
• NCBI Accession #: NP_001182502.1
• NCBI GenBank Nucleotide #: NM_001195573.1
• UniProt Accession #: Q9UPY3; O95943; Q9UQ02; A7E2D3; B3KRG4; E0AD28
• Molecular Weight: 92,726 Da
• NCBI Official Full Name: endoribonuclease Dicer isoform 2
• NCBI Official Synonym Full Names: dicer 1, ribonuclease III
• NCBI Official Symbol: DICER1
• NCBI Official Synonym Symbols: DCR1; MNG1; Dicer; HERNA; RMSE2; Dicer1e; K12H4.8-LIKE
• NCBI Protein Information: endoribonuclease Dicer
• UniProt Protein Name: Endoribonuclease Dicer
• Protein Family: Endoribonuclease
• UniProt Gene Name: DICER1
• UniProt Synonym Gene Names: DICER; HERNA; KIAA0928; Helicase MOI

NCBI Description

This gene encodes a protein possessing an RNA helicase motif containing a DEXH box in its amino terminus and an RNA motif in the carboxy terminus. The encoded protein functions as a ribonuclease and is required by the RNA interference and small temporal RNA (stRNA) pathways to produce the active small RNA component that represses gene expression. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2010]

Uniprot Description

Double-stranded RNA (dsRNA) endoribonuclease playing a central role in short dsRNA-mediated post-transcriptional gene silencing. Cleaves naturally occurring long dsRNAs and short hairpin pre-microRNAs (miRNA) into fragments of twenty-one to twenty-three nucleotides with 3' overhang of two nucleotides, producing respectively short interfering RNAs (siRNA) and mature microRNAs. SiRNAs and miRNAs serve as guide to direct the RNA-induced silencing complex (RISC) to complementary RNAs to degrade them or prevent their translation. Gene silencing mediated by siRNAs, also called RNA interference, controls the elimination of transcripts from mobile and repetitive DNA elements of the genome but also the degradation of exogenous RNA of viral origin for instance. The miRNA pathway on the other side is a mean to specifically regulate the expression of target genes.