CTP-dependent diacylglycerol kinase 1 (DGK1) Recombinant Protein | DGK1 recombinant protein
Recombinant Saccharomyces cerevisiae CTP-dependent diacylglycerol kinase 1 (DGK1)
Gene Names
DGK1; HSD1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
CTP-dependent diacylglycerol kinase 1 (DGK1); Recombinant Saccharomyces cerevisiae CTP-dependent diacylglycerol kinase 1 (DGK1); DGK1 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-290aa; full length protein
Sequence
MGTEDAIALPNSTLEPRTEAKQRLSSKSHQVSAKVTIPAKEEISSSDDDAHVPVTEIHLK SHEWFGDFITKHEIPRKVFHSSIGFITLYLYTQGINYKNVLWPLIYAFIILFILDLIRLN WPFFNMLYCRTVGALMRKKEIHTYNGVLWYILGLIFSFNFFSKDVTLISLFLLSWSDTAA ATIGRKYGHLTPKVARNKSLAGSIAAFTVGVITCWVFYGYFVPAYSYVNKPGEIQWSPET SRLSLNMLSLLGGVVAALSEGIDLFNWDDNFTIPVLSSLFMNAVIKTFKK
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for DGK1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
32,840 Da
NCBI Official Full Name
diacylglycerol kinase
NCBI Official Symbol
DGK1
NCBI Official Synonym Symbols
HSD1
NCBI Protein Information
diacylglycerol kinase
UniProt Protein Name
CTP-dependent diacylglycerol kinase 1
Protein Family
UniProt Gene Name
DGK1
UniProt Synonym Gene Names
HSD1; DAG kinase 1
UniProt Entry Name
DGK1_YEAST
Uniprot Description
Involved in pre-tRNA splicing (). CTP-dependent diacylglycerol kinase that catalyzes the phosphorylation of diacylglycerol (DAG) to phosphatidate (PA). Controls phosphatidate levels at the nuclear envelope. Counteracts the activity of PAH1/SMP2. Involved in the resistance to nickel chloride and nalidixic acid. May be involved in vesicle trafficking between the endoplasmic reticulum and the Golgi apparatus.
Research Articles on DGK1
Similar Products
Product Notes
The DGK1 dgk1 (Catalog #AAA7013751) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-290aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the DGK1 dgk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGTEDAIALP NSTLEPRTEA KQRLSSKSHQ VSAKVTIPAK EEISSSDDDA HVPVTEIHLK SHEWFGDFIT KHEIPRKVFH SSIGFITLYL YTQGINYKNV LWPLIYAFII LFILDLIRLN WPFFNMLYCR TVGALMRKKE IHTYNGVLWY ILGLIFSFNF FSKDVTLISL FLLSWSDTAA ATIGRKYGHL TPKVARNKSL AGSIAAFTVG VITCWVFYGY FVPAYSYVNK PGEIQWSPET SRLSLNMLSL LGGVVAALSE GIDLFNWDDN FTIPVLSSLF MNAVIKTFKK. It is sometimes possible for the material contained within the vial of "CTP-dependent diacylglycerol kinase 1 (DGK1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
