Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GBAS Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: THP-1 cell lysate)

Rabbit NIPSNAP2 Polyclonal Antibody | anti-NIPSNAP2 antibody

NIPSNAP2 Antibody - middle region

Gene Names
NIPSNAP2; GBAS
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NIPSNAP2; Polyclonal Antibody; NIPSNAP2 Antibody - middle region; anti-NIPSNAP2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VPRSGPNIYELRSYQLRPGTMIEWGNYWARAIRFRQDGNEAVGGFFSQIG
Sequence Length
286
Applicable Applications for anti-NIPSNAP2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%; Zebrafish: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GBAS
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GBAS Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: THP-1 cell lysate)

Western Blot (WB) (WB Suggested Anti-GBAS Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: THP-1 cell lysate)
Related Product Information for anti-NIPSNAP2 antibody
This is a rabbit polyclonal antibody against GBAS. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes a member of the NipSnap family of proteins that may be involved in vesicular transport. The encoded protein is localized to mitochondria and plays a role in oxidative phosphorylation. A pseudogene of this gene is located on the long arm of chromosome 2. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Product Categories/Family for anti-NIPSNAP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
protein NipSnap homolog 2 isoform 1
NCBI Official Synonym Full Names
nipsnap homolog 2
NCBI Official Symbol
NIPSNAP2
NCBI Official Synonym Symbols
GBAS
NCBI Protein Information
protein NipSnap homolog 2
UniProt Protein Name
Protein NipSnap homolog 2
UniProt Gene Name
GBAS
UniProt Synonym Gene Names
NIPSNAP2; NipSnap2
UniProt Entry Name
NIPS2_HUMAN

NCBI Description

This gene encodes a member of the NipSnap family of proteins that may be involved in vesicular transport. The encoded protein is localized to mitochondria and plays a role in oxidative phosphorylation. A pseudogene of this gene is located on the long arm of chromosome 2. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Feb 2011]

Uniprot Description

GBAS: a member of the NipSnap family of proteins that may be involved in vesicular transport. The encoded protein is localized to mitochondria and plays a role in oxidative phosphorylation. A pseudogene of this gene is located on the long arm of chromosome 2. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Feb 2011]

Protein type: Autophagy; Cell surface

Chromosomal Location of Human Ortholog: 7p12

Cellular Component: membrane; mitochondrion; integral to plasma membrane

Molecular Function: protein binding

Biological Process: ATP biosynthetic process; oxidative phosphorylation

Research Articles on NIPSNAP2

Similar Products

Product Notes

The NIPSNAP2 gbas (Catalog #AAA3208892) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NIPSNAP2 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's NIPSNAP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NIPSNAP2 gbas for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VPRSGPNIYE LRSYQLRPGT MIEWGNYWAR AIRFRQDGNE AVGGFFSQIG. It is sometimes possible for the material contained within the vial of "NIPSNAP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.