Escherichia coli Probable diguanylate cyclase AdrA (adrA) Recombinant Protein | yaiC recombinant protein
Recombinant Escherichia coli Probable diguanylate cyclase AdrA (adrA), partial
Gene Names
yaiC; adrA; ECK0380; JW0376
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Escherichia coli Probable diguanylate cyclase AdrA (adrA); Recombinant Escherichia coli Probable diguanylate cyclase AdrA (adrA); partial; yaiC recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
192-371. Fragment at the C-terminal.
Sequence
SYQTATKLAEHKRRLQVMSTRDGMTGVYNRRHWETMLRNEFDNCRRHNRDATLLIIDIDHFKSINDTWGHDVGDEAIVALTRQLQITLRGSDVIGRFGGDEFAVIMSGTPAESAITAMLRVHEGLNTLRLPNTPQVTLRISVGVAPLNPQMSHYREWLKSADLALYKAKKAGRNRTEVAA
Sequence Length
371
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
41,537 Da
NCBI Official Full Name
diguanylate cyclase, cellulose regualtor
NCBI Official Symbol
yaiC
NCBI Official Synonym Symbols
adrA; ECK0380; JW0376
NCBI Protein Information
diguanylate cyclase, cellulose regualtor
UniProt Protein Name
Probable diguanylate cyclase DgcC
UniProt Gene Name
dgcC
UniProt Synonym Gene Names
DGC
NCBI Description
AdrA contains a GGDEF domain. [More information is available at EcoGene: EG11257]. Cellulose production is a common trait in wild isolates of Escherichia coli, but not in K-12 strains . [More information is available at EcoCyc: EG11257].
Uniprot Description
A probable diguanylate cyclase. The last member of a cascade of expressed proteins, its expression requires DgcM. DgcC production induces biosynthesis of cellulose in some E.coli isolates, but not in K12 strains. Cyclic-di-GMP is a second messenger which controls cell surface-associated traits in bacteria.
Research Articles on yaiC
Similar Products
Product Notes
The yaiC dgcc (Catalog #AAA1221905) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 192-371. Fragment at the C-terminal. The amino acid sequence is listed below: SYQTATKLAE HKRRLQVMST RDGMTGVYNR RHWETMLRNE FDNCRRHNRD ATLLIIDIDH FKSINDTWGH DVGDEAIVAL TRQLQITLRG SDVIGRFGGD EFAVIMSGTP AESAITAMLR VHEGLNTLRL PNTPQVTLRI SVGVAPLNPQ MSHYREWLKS ADLALYKAKK AGRNRTEVAA . It is sometimes possible for the material contained within the vial of "Escherichia coli Probable diguanylate cyclase AdrA (adrA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
