Probable diguanylate cyclase YedQ Recombinant Protein | yedQ recombinant protein

Recombinant E Coli Probable diguanylate cyclase YedQ

Cat. Num. AAA717153

• Gene Names: yedQ; ECK1954; JW5832
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Probable diguanylate cyclase YedQ; Recombinant E Coli Probable diguanylate cyclase YedQ; Cellulose synthesis regulatory protein; yedQ recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 381-564aa; Partial
• Sequence: RRMVSNMYVLQSSLQWQAWHDTLTRLYNRGALFEKARPLAKLCQTHQHPFSVIQVDLDHFKAINDRFGHQAGDRVLSHAAGLISSSLRAQDVAGRVGGEEFCVILPGASLTEAAEVAERIRLKLNEKEMLIAKSTTIRISASLGVSSSEETGDYDFEQLQSLADRRLYLAKQAGRNRVFASDNA
• Sequence Length: 564

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for yedQ recombinant protein

Involved in the regulation of cellulose production. Cyclic-di-GMP is a second messenger which controls cell surface-associated traits in bacteria.

References

A 460-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 40.1-50.0 min region on the linkage map.Itoh T., Aiba H., Baba T., Fujita K., Hayashi K., Inada T., Isono K., Kasai H., Kimura S., Kitakawa M., Kitagawa M., Makino K., Miki T., Mizobuchi K., Mori H., Mori T., Motomura K., Nakade S., Nakamura Y., Nashimoto H., Nishio Y., Oshima T., Saito N., Sampei G., Seki Y., Sivasundaram S., Tagami H., Takeda J., Takemoto K., Wada C., Yamamoto Y., Horiuchi T.DNA Res. 3:379-392(1996) The complete genome sequence of Escherichia coli K-12.Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y.Science 277:1453-1462(1997) Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006) A CsgD-independent pathway for cellulose production and biofilm formation in Escherichia coli.Da Re S., Ghigo J.-M.J. Bacteriol. 188:3073-3087(2006) Cyclic-di-GMP-mediated signalling within the sigma network of Escherichia coli.Weber H., Pesavento C., Possling A., Tischendorf G., Hengge R.Mol. Microbiol. 62:1014-1034(2006) Gene expression patterns and differential input into curli fimbriae regulation of all GGDEF/EAL domain proteins in Escherichia coli.Sommerfeldt N., Possling A., Becker G., Pesavento C., Tschowri N., Hengge R.Microbiology 155:1318-1331(2009) Second messenger-mediated adjustment of bacterial swimming velocity.Boehm A., Kaiser M., Li H., Spangler C., Kasper C.A., Ackermann M., Kaever V., Sourjik V., Roth V., Jenal U.Cell 141:107-116(2010)

NCBI and Uniprot Product Information

• NCBI GI #: 90111360
• NCBI GeneID: 946471
• NCBI Accession #: NP_416465.2
• NCBI GenBank Nucleotide #: NC_000913.3
• UniProt Accession #: P76330; P94746
• Molecular Weight: 47.5 kDa
• NCBI Official Full Name: putative membrane-anchored diguanylate cyclase
• NCBI Official Symbol: yedQ
• NCBI Official Synonym Symbols: ECK1954; JW5832
• NCBI Protein Information: putative membrane-anchored diguanylate cyclase
• UniProt Protein Name: Probable diguanylate cyclase YedQ
• Protein Family: Probable diguanylate cyclase
• UniProt Gene Name: yedQ
• UniProt Synonym Gene Names: DGC
• UniProt Entry Name: YEDQ_ECOLI

NCBI Description

A null ydeQ mutation slightly suppresses the motility defect of a yhjH null mutant at 28C and 37C; a yedQ mutation is needed in addition to yegE (28C) or yegE yeaJ (37) to restore full motility to the yhjH mutant (Pesavento, 2008).YedQ has a C-terminal GGDEF domain. [More information is available at EcoGene: EG14040]. Expression of yedQ is dependent on S under a number of stress conditions. [More information is available at EcoCyc: G7049].

Uniprot Description

Involved in the regulation of cellulose production. Cyclic-di-GMP is a second messenger which controls cell surface-associated traits in bacteria.