Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

DNA fragmentation factor subunit alpha (DFFA) Recombinant Protein | DFFA recombinant protein

Recombinant Human DNA fragmentation factor subunit alpha (DFFA)

Gene Names
DFFA; DFF1; ICAD; DFF-45
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
DNA fragmentation factor subunit alpha (DFFA); Recombinant Human DNA fragmentation factor subunit alpha (DFFA); DNA fragmentation factor subunit alpha; DNA fragmentation factor 45 kDa subunit; DFF-45; Inhibitor of CAD; ICAD; DFFA recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-331aa; Full Length of BC007721
Sequence
MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVTLVLAEDGTIVDDDDYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGAGLKWKNVARQLKEDLSSIILLSEEDLQMLVDAPCSDLAQELRQSCATVQRLQHTLQQVLDQREEVRQSKQLLQLYLQALEKEGSLLSKQEESKAAFGEEVDAVDTGISRETSSDVALASHILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACEWELALRLQQTQSLHSLRSISASKASPPGDLQNPKRARQDPT
Sequence Length
331
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for DFFA recombinant protein
DFFA; DFF1, DFF45; H13
Product Categories/Family for DFFA recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63.6 kDa
NCBI Official Full Name
DNA fragmentation factor subunit alpha isoform 1
NCBI Official Synonym Full Names
DNA fragmentation factor, 45kDa, alpha polypeptide
NCBI Official Symbol
DFFA
NCBI Official Synonym Symbols
DFF1; ICAD; DFF-45
NCBI Protein Information
DNA fragmentation factor subunit alpha; DFF45; inhibitor of CAD; DNA fragmentation factor 45 kDa subunit
UniProt Protein Name
DNA fragmentation factor subunit alpha
Protein Family
UniProt Gene Name
DFFA
UniProt Synonym Gene Names
DFF1; DFF45; DFF-45; ICAD
UniProt Entry Name
DFFA_HUMAN

NCBI Description

Apoptosis is a cell death process that removes toxic and/or useless cells during mammalian development. The apoptotic process is accompanied by shrinkage and fragmentation of the cells and nuclei and degradation of the chromosomal DNA into nucleosomal units. DNA fragmentation factor (DFF) is a heterodimeric protein of 40-kD (DFFB) and 45-kD (DFFA) subunits. DFFA is the substrate for caspase-3 and triggers DNA fragmentation during apoptosis. DFF becomes activated when DFFA is cleaved by caspase-3. The cleaved fragments of DFFA dissociate from DFFB, the active component of DFF. DFFB has been found to trigger both DNA fragmentation and chromatin condensation during apoptosis. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

DFFA: Inhibitor of the caspase-activated DNase (DFF40). Heterodimer of DFFA and DFFB. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Hydrolase

Chromosomal Location of Human Ortholog: 1p36.3-p36.2

Cellular Component: nucleoplasm; cytoplasm; nuclear chromatin; lipid particle; cytosol; nucleus

Molecular Function: protein binding

Biological Process: apoptosis; positive regulation of apoptosis; DNA fragmentation during apoptosis; cell structure disassembly during apoptosis

Research Articles on DFFA

Similar Products

Product Notes

The DFFA dffa (Catalog #AAA1228387) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-331aa; Full Length of BC007721. The amino acid sequence is listed below: MEVTGDAGVP ESGEIRTLKP CLLRRNYSRE QHGVAASCLE DLRSKACDIL AIDKSLTPVT LVLAEDGTIV DDDDYFLCLP SNTKFVALAS NEKWAYNNSD GGTAWISQES FDVDETDSGA GLKWKNVARQ LKEDLSSIIL LSEEDLQMLV DAPCSDLAQE LRQSCATVQR LQHTLQQVLD QREEVRQSKQ LLQLYLQALE KEGSLLSKQE ESKAAFGEEV DAVDTGISRE TSSDVALASH ILTALREKQA PELSLSSQDL ELVTKEDPKA LAVALNWDIK KTETVQEACE WELALRLQQT QSLHSLRSIS ASKASPPGDL QNPKRARQDP T. It is sometimes possible for the material contained within the vial of "DNA fragmentation factor subunit alpha (DFFA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.