Degradation in the endoplasmic reticulum protein 1 (DER1) Recombinant Protein | DER1 recombinant protein
Recombinant Saccharomyces cerevisiae Degradation in the endoplasmic reticulum protein 1 (DER1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Degradation in the endoplasmic reticulum protein 1 (DER1); Recombinant Saccharomyces cerevisiae Degradation in the endoplasmic reticulum protein 1 (DER1); Recombinant Degradation in the endoplasmic reticulum protein 1 (DER1); Degradation in the endoplasmic reticulum protein 1; DER1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-211
Sequence
MDAVILNLLGDIPLVTRLWTIGCLVLSGLTSLRIVDPGKVVYSYDLVFKKGQYGRLLYSIFDYGAFNWISMINIFVSANHLSTLENSFNLRRKFCWIIFLLLVILVKMTSIEQPAASLGVLLHENLVYYELKKNGNQMNVRFFGAIDVSPSIFPIYMNAVMYFVYKRSWLEIAMNFMPGHVIYYMDDIIGKIYGIDLCKSPYDWFRNTETP
Sequence Length
211
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
24,391 Da
NCBI Official Full Name
Der1p
NCBI Official Symbol
DER1
NCBI Protein Information
Der1p
UniProt Protein Name
Degradation in the endoplasmic reticulum protein 1
Protein Family
UniProt Gene Name
DER1
UniProt Entry Name
DER1_YEAST
Uniprot Description
Function: Specifically required for the degradation process of misfolded endoplasmic reticulum (ER) luminal proteins. Probably participates in the transfer of misfolded proteins from the ER to the cytosol, where they are destroyed by the proteasome in a ubiquitin-dependent manner. Ref.1
Subcellular location: Endoplasmic reticulum membrane; Multi-pass membrane protein Ref.1.
Induction: Up-regulated by the unfolded protein response (UPR). Ref.5
Miscellaneous: Present with 238 molecules/cell in log phase SD medium.
Sequence similarities: Belongs to the derlin family.
Sequence caution: The sequence CAA79688.1 differs from that shown. Reason: Frameshift at position 40.
Research Articles on DER1
1. Data show that Der1p appears to have a role in a pathway that is parallel to that involving Hrd3p.
Similar Products
Product Notes
The DER1 der1 (Catalog #AAA1003321) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-211. The amino acid sequence is listed below: MDAVILNLLG DIPLVTRLWT IGCLVLSGLT SLRIVDPGKV VYSYDLVFKK GQYGRLLYSI FDYGAFNWIS MINIFVSANH LSTLENSFNL RRKFCWIIFL LLVILVKMTS IEQPAASLGV LLHENLVYYE LKKNGNQMNV RFFGAIDVSP SIFPIYMNAV MYFVYKRSWL EIAMNFMPGH VIYYMDDIIG KIYGIDLCKS PYDWFRNTET P. It is sometimes possible for the material contained within the vial of "Degradation in the endoplasmic reticulum protein 1 (DER1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
