Putative protease Do-like 11, mitochondrial (DEGP11) Recombinant Protein | DEGP11 recombinant protein
Recombinant Arabidopsis thaliana Putative protease Do-like 11, mitochondrial (DEGP11)
Gene Names
DEG11; DegP protease 11; DegP11; degradation of periplasmic proteins 11
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative protease Do-like 11; mitochondrial (DEGP11); Recombinant Arabidopsis thaliana Putative protease Do-like 11; DEGP11 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
66-560, Full length protein
Sequence
GVFLPFALTCRRNIHSIHEDEKKLERWKKIEESHPLDELVLDSVVKVFSNSTEYSKSKPWKTLDQKSSRGTGFAIAGRKILTNAHVVMAMNDHTFVDVKRHGSQIKYKAKVQKISHECDLAILEIDSDEFWKGMNPLELGDIPPLQEVVSVVGGENICITKGLVLRVETRIYDYSDSDLLSIQIDATINDENSGGPVIMGNKVVGVVYEIGFVIPTPIIKHFITSVQESRQYSCFGSLDLSYQSLENVQIRNHFKMSHEMTGILINKINSSSGAYKILRKDDIILAIDGVPIGNDEKVPFQNKRRIDFSYLVSMKKPGEKALVKVLRNGKEYEYNISLKPVKPNFTVQQFYNVPSYYIFGGFVFVPLTKTYLDSEHHQVKISERLADDINEGYQSLYGAQVEKVNGVEVKNLKHLCELIEECSTEDLRLEFKNHKVLVLNYESAKKATLQILERHKIKSVISKDICLPMLLDDPFKDNKINLLPWSVLPLMFDFS
Sequence Length
495
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
63,695 Da
NCBI Official Full Name
DegP protease 11
NCBI Official Symbol
DEG11
NCBI Official Synonym Symbols
DegP protease 11; DegP11; degradation of periplasmic proteins 11
NCBI Protein Information
DegP protease 11
UniProt Protein Name
Putative protease Do-like 11, mitochondrial
Protein Family
UniProt Gene Name
DEGP11
NCBI Description
Encodes a putative DegP protease.
Uniprot Description
Putative serine protease.
Similar Products
Product Notes
The DEGP11 degp11 (Catalog #AAA1480639) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 66-560, Full length protein. The amino acid sequence is listed below: GVFLPFALTC RRNIHSIHED EKKLERWKKI EESHPLDELV LDSVVKVFSN STEYSKSKPW KTLDQKSSRG TGFAIAGRKI LTNAHVVMAM NDHTFVDVKR HGSQIKYKAK VQKISHECDL AILEIDSDEF WKGMNPLELG DIPPLQEVVS VVGGENICIT KGLVLRVETR IYDYSDSDLL SIQIDATIND ENSGGPVIMG NKVVGVVYEI GFVIPTPIIK HFITSVQESR QYSCFGSLDL SYQSLENVQI RNHFKMSHEM TGILINKINS SSGAYKILRK DDIILAIDGV PIGNDEKVPF QNKRRIDFSY LVSMKKPGEK ALVKVLRNGK EYEYNISLKP VKPNFTVQQF YNVPSYYIFG GFVFVPLTKT YLDSEHHQVK ISERLADDIN EGYQSLYGAQ VEKVNGVEVK NLKHLCELIE ECSTEDLRLE FKNHKVLVLN YESAKKATLQ ILERHKIKSV ISKDICLPML LDDPFKDNKI NLLPWSVLPL MFDFS. It is sometimes possible for the material contained within the vial of "Putative protease Do-like 11, mitochondrial (DEGP11), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
