Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

Beta-defensin 126 Recombinant Protein | DEFB126 recombinant protein

Recombinant Pongo pygmaeus Beta-defensin 126

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Beta-defensin 126; Recombinant Pongo pygmaeus Beta-defensin 126; Defensin; beta 126; DEFB126 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
21-63aa; Full length of Beta-defensin 126 domain
Sequence
SWYVKKCLNDVGICKKKCKPEELHVKNGWAMCGKQRDCCVPAD
Sequence Length
118
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

SDS-Page
Related Product Information for DEFB126 recombinant protein
Has antibacterial activity. Curated
References
Evolution and sequence variation of human beta-defensin genes.Hollox E.J., Armour J.A.L.

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
32.31kD
NCBI Official Full Name
Beta-defensin 126
UniProt Protein Name
Beta-defensin 126
Protein Family
UniProt Gene Name
DEFB126
UniProt Entry Name
DB126_PONPY

Uniprot Description

Highly glycosylated atypical beta-defensin involved in several aspects of sperm function. Facilitates sperm transport in the female reproductive tract and contributes to sperm protection against immunodetection; both functions are probably implicating the negative surface charge provided by its O-linked oligosaccharides in the sperm glycocalyx. Involved in binding of sperm to oviductal epithelial cells to form a sperm reservoir until ovulation. Release from the sperm surface during capacitation and ovaluation by an elevation of oviductal fluid pH is unmasking other surface components and allows sperm to penetrate the cumulus matrix and bind to the zona pellucida of the oocyte. In vitro has antimicrobial activity and may inhibit LPS-mediated inflammation ().

Similar Products

Product Notes

The DEFB126 defb126 (Catalog #AAA1067637) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-63aa; Full length of Beta-defensin 126 domain. The amino acid sequence is listed below: SWYVKKCLND VGICKKKCKP EELHVKNGWA MCGKQRDCCV PAD. It is sometimes possible for the material contained within the vial of "Beta-defensin 126, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.