Beta-defensin 124 Recombinant Protein | DEFB124 recombinant protein

Recombinant Human Beta-defensin 124

Cat. Num. AAA1305137

• Gene Names: DEFB124; DEFB-24
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Beta-defensin 124; Recombinant Human Beta-defensin 124; Beta-defensin 24; DEFB-24; Defensin; beta 124; DEFB124 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 23-71. Full Length of Mature Protein
• Sequence: EFKRCWKGQGACQTYCTRQETYMHLCPDASLCCLSYALKPPPVPKHEYE

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for DEFB124 recombinant protein

Has antibacterial activity. Curated

References

Cross-species analysis of the mammalian beta-defensin gene family presence of syntenic gene clusters and preferential expression in the male reproductive tract.Patil A.A., Cai Y., Sang Y., Blecha F., Zhang G.Physiol. Genomics 23:5-17(2005) The DNA sequence and comparative analysis of human chromosome 20.Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.Nature 414:865-871(2001) Discovery of five conserved beta-defensin gene clusters using a computational search strategy.Schutte B.C., Mitros J.P., Bartlett J.A., Walters J.D., Jia H.P., Welsh M.J., Casavant T.L., McCray P.B. Jr.Proc. Natl. Acad. Sci. U.S.A. 99:2129-2133(2002)

NCBI and Uniprot Product Information

• NCBI GI #: 82734223
• NCBI GeneID: 245937
• NCBI Accession #: NP_001032589.1
• NCBI GenBank Nucleotide #: NM_001037500.1
• UniProt Accession #: Q8NES8; Q30E74
• Molecular Weight: 21.7 kDa
• NCBI Official Full Name: beta-defensin 124
• NCBI Official Synonym Full Names: defensin beta 124
• NCBI Official Symbol: DEFB124
• NCBI Official Synonym Symbols: DEFB-24
• NCBI Protein Information: beta-defensin 124
• UniProt Protein Name: Beta-defensin 124
• Protein Family: Beta-defensin
• UniProt Gene Name: DEFB124
• UniProt Synonym Gene Names: DEFB24; DEFB-24
• UniProt Entry Name: DB124_HUMAN

NCBI Description

Defensins are cysteine-rich cationic polypeptides that are important in the host immunologic response to invading microorganisms. This antimicrobial protein is secreted and is a member of the beta defensin protein family. Beta defensin genes are found in several clusters throughout the genome, with this gene mapping to a cluster at 20q11.1. The encoded protein may serve to enhance innate immunity in the prostate. [provided by RefSeq, Nov 2014]

Uniprot Description

DEFB124: Has antibacterial activity (Potential). Belongs to the beta-defensin family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 20q11.1

Cellular Component: cell surface; extracellular region

Biological Process: defense response to bacterium; innate immune response