Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ATP-dependent RNA helicase DDX39A (DDX39A) Recombinant Protein | DDX39A recombinant protein

Recombinant Human ATP-dependent RNA helicase DDX39A (DDX39A)

Gene Names
DDX39A; BAT1; DDXL; BAT1L; DDX39; URH49
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ATP-dependent RNA helicase DDX39A (DDX39A); Recombinant Human ATP-dependent RNA helicase DDX39A (DDX39A); DDX39A recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-427, Full length protein
Sequence
AEQDVENDLLDYDEEEEPQAPQESTPAPPKKDIKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQIEPVNGQVTVLVMCHTRELAFQISKEYERFSKYMPSVKVSVFFGGLSIKKDEEVLKKNCPHVVVGTPGRILALVRNRSFSLKNVKHFVLDECDKMLEQLDMRRDVQEIFRLTPHEKQCMMFSATLSKDIRPVCRKFMQDPMEVFVDDETKLTLHGLQQYYVKLKDSEKNRKLFDLLDVLEFNQVIIFVKSVQRCMALAQLLVEQNFPAIAIHRGMAQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIVFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNVAELPEEIDISTYIEQSR
Sequence Length
426
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for DDX39A recombinant protein
This gene encodes a member of the DEAD box protein family. These proteins are characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD) and are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30,488 Da
NCBI Official Full Name
ATP-dependent RNA helicase DDX39A
NCBI Official Synonym Full Names
DExD-box helicase 39A
NCBI Official Symbol
DDX39A
NCBI Official Synonym Symbols
BAT1; DDXL; BAT1L; DDX39; URH49
NCBI Protein Information
ATP-dependent RNA helicase DDX39A
UniProt Protein Name
ATP-dependent RNA helicase DDX39A
UniProt Gene Name
DDX39A
UniProt Synonym Gene Names
DDX39

NCBI Description

This gene encodes a member of the DEAD box protein family. These proteins are characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD) and are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene is thought to play a role in the prognosis of patients with gastrointestinal stromal tumors. A pseudogene of this gene is present on chromosome 13. Alternate splicing results in multiple transcript variants. Additional alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. [provided by RefSeq, Sep 2013]

Uniprot Description

Isoform 1: Involved in pre-mRNA splicing. Required for the export of mRNA out of the nucleus.

Research Articles on DDX39A

Similar Products

Product Notes

The DDX39A ddx39a (Catalog #AAA1091068) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-427, Full length protein. The amino acid sequence is listed below: AEQDVENDLL DYDEEEEPQA PQESTPAPPK KDIKGSYVSI HSSGFRDFLL KPELLRAIVD CGFEHPSEVQ HECIPQAILG MDVLCQAKSG MGKTAVFVLA TLQQIEPVNG QVTVLVMCHT RELAFQISKE YERFSKYMPS VKVSVFFGGL SIKKDEEVLK KNCPHVVVGT PGRILALVRN RSFSLKNVKH FVLDECDKML EQLDMRRDVQ EIFRLTPHEK QCMMFSATLS KDIRPVCRKF MQDPMEVFVD DETKLTLHGL QQYYVKLKDS EKNRKLFDLL DVLEFNQVII FVKSVQRCMA LAQLLVEQNF PAIAIHRGMA QEERLSRYQQ FKDFQRRILV ATNLFGRGMD IERVNIVFNY DMPEDSDTYL HRVARAGRFG TKGLAITFVS DENDAKILND VQDRFEVNVA ELPEEIDIST YIEQSR. It is sometimes possible for the material contained within the vial of "ATP-dependent RNA helicase DDX39A (DDX39A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.