Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Probable D,D-dipeptide transport system permease protein ddpC (ddpC) Recombinant Protein | ddpC recombinant protein

Recombinant Escherichia coli Probable D,D-dipeptide transport system permease protein ddpC (ddpC)

Gene Names
ddpC; ECK1479; JW1480; yddQ
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable D; D-dipeptide transport system permease protein ddpC (ddpC); Recombinant Escherichia coli Probable D; Recombinant Probable D; D-dipeptide transport system permease protein ddpC; ddpC recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-298
Sequence
MMLSEETSAVRPQKQTRFNGAKLVWMLKGSPLTVTSAVIIVLMLLMMIFSPWLATHDPNAIDLTARLLPPSAAHWFGTDEVGRDLFSRVLVGSQQSILAGLVVVAIAGMIGSLLGCLSGVLGGRADAIIMRIMDIMLSIPSLVLTMALAAALGPSLFNAMLAIAIVRIPFYVRLARGQALVVRQYTYVQAAKTFGASRWHLINWHILRNSLPPLIVQASLDIGSAILMAATLGFIGLGAQQPSAEWGAMVANGRNYVLDQWWYCAFPGAAILLTAVGFNLFGDGIRDLLDPKAGGKQS
Sequence Length
298
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31,971 Da
NCBI Official Full Name
D-ala-D-ala transporter subunit
NCBI Official Symbol
ddpC
NCBI Official Synonym Symbols
ECK1479; JW1480; yddQ
NCBI Protein Information
D-ala-D-ala transporter subunit
UniProt Protein Name
Probable D,D-dipeptide transport system permease protein DdpC
UniProt Gene Name
ddpC
UniProt Synonym Gene Names
yddQ
UniProt Entry Name
DDPC_ECOLI

NCBI Description

Topology mapped using protein fusions. [More information is available at EcoGene: EG13788]. YddQ is a membrane component of a predicted peptide ABC transporter. [More information is available at EcoCyc: G6779].

Uniprot Description

Function: Part of the ABC transporter complex DdpABCDF, which is probably involved in D,D-dipeptide transport. Probably responsible for the translocation of the substrate across the membrane.

Subunit structure: The complex is composed of two ATP-binding proteins (DdpD and DdpF), two transmembrane proteins (DdpB and DdpC) and a solute-binding protein (DdpA)

Probable.

Subcellular location: Cell inner membrane; Multi-pass membrane protein.

Induction: Induced by RpoS in stationary phase. Ref.4

Sequence similarities: Belongs to the binding-protein-dependent transport system permease family. OppBC subfamily.Contains 1 ABC transmembrane type-1 domain.

Similar Products

Product Notes

The ddpC ddpc (Catalog #AAA1020354) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-298. The amino acid sequence is listed below: MMLSEETSAV RPQKQTRFNG AKLVWMLKGS PLTVTSAVII VLMLLMMIFS PWLATHDPNA IDLTARLLPP SAAHWFGTDE VGRDLFSRVL VGSQQSILAG LVVVAIAGMI GSLLGCLSGV LGGRADAIIM RIMDIMLSIP SLVLTMALAA ALGPSLFNAM LAIAIVRIPF YVRLARGQAL VVRQYTYVQA AKTFGASRWH LINWHILRNS LPPLIVQASL DIGSAILMAA TLGFIGLGAQ QPSAEWGAMV ANGRNYVLDQ WWYCAFPGAA ILLTAVGFNL FGDGIRDLLD PKAGGKQS. It is sometimes possible for the material contained within the vial of "Probable D,D-dipeptide transport system permease protein ddpC (ddpC), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.