Dynactin subunit 3 Recombinant Protein | DCTN3 recombinant protein

Recombinant Human Dynactin subunit 3

Cat. Num. AAA1065589

• Gene Names: DCTN3; DCTN22; DCTN-22
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Dynactin subunit 3; Recombinant Human Dynactin subunit 3; Dynactin complex subunit 22 kDa subunit; p22; DCTN3 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-176aa; Full Length of Mature Protein of Isoform 2
• Sequence: AGLTDLQRLQARVEELERWVYGPGGARGSRKVADGLVKVQVALGNISSKRERVKILYKKIEDLIKYLDPEYIDRIAIPDASKLQFILAEEQFILSQVALLEQVNALVPMLDSAHIKAVPEHAARLQRLAQIHIQQQAPWGVGVRDEAGSLVEDVGFAQFLSVLHFGPTGPVCGNH

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for DCTN3 recombinant protein

Together with dynein may be involved in spindle assembly and cytokinesis.

Product Categories/Family for DCTN3 recombinant protein

Cell Cycle

References

Characterization of the p22 subunit of dynactin reveals the localization of cytoplasmic dynein and dynactin to the midbody of dividing cells.Karki S., LaMonte B., Holzbaur E.L.F.J. Cell Biol. 142:1023-1034(1998)

NCBI and Uniprot Product Information

• NCBI GI #: 526479822
• NCBI GeneID: 11258
• NCBI Accession #: NP_001268354.1
• NCBI GenBank Nucleotide #: NM_001281425.1
• UniProt Accession #: O75935; Q5T1I5; Q5T1I7; Q5T8G3; Q9BPU8; A6NII7; B2RBM5
• Molecular Weight: 35.3 kDa
• NCBI Official Full Name: dynactin subunit 3 isoform 3
• NCBI Official Synonym Full Names: dynactin subunit 3
• NCBI Official Symbol: DCTN3
• NCBI Official Synonym Symbols: DCTN22; DCTN-22
• NCBI Protein Information: dynactin subunit 3
• UniProt Protein Name: Dynactin subunit 3
• Protein Family: Dynactin
• UniProt Gene Name: DCTN3
• UniProt Synonym Gene Names: p22
• UniProt Entry Name: DCTN3_HUMAN

NCBI Description

This gene encodes the smallest subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, cytokinesis, chromosome movement, nuclear positioning, and axonogenesis. This subunit, like most other dynactin subunits, exists only as a part of the dynactin complex. It is primarily an alpha-helical protein with very little coiled coil, and binds directly to the largest subunit (p150) of dynactin. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]

Uniprot Description

dynactin 3: Together with dynein may be involved in spindle assembly and cytokinesis. Belongs to the dynactin subunit 3 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Motor; Microtubule-binding; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 9p13

Cellular Component: centrosome; cleavage furrow; cytosol; dynactin complex; midbody; perinuclear region of cytoplasm; spindle

Molecular Function: protein binding; structural molecule activity

Biological Process: antigen processing and presentation of exogenous peptide antigen via MHC class II; cellular protein metabolic process; cytokinesis; ER to Golgi vesicle-mediated transport; G2/M transition of mitotic cell cycle; microtubule-based process; mitosis; mitotic cell cycle; organelle organization and biogenesis; post-translational protein modification; protein amino acid N-linked glycosylation via asparagine