Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

Decorin Recombinant Protein | Dcn recombinant protein

Recombinant Mouse Decorin

Gene Names
Dcn; DC; PG40; PGII; PGS2; DSPG2; SLRR1B
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Decorin; Recombinant Mouse Decorin; Bone proteoglycan II; PG-S2; PG40; Dcn recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
35-354aa; Partial
Sequence
GIIPYDPDNPLISMCPYRCQCHLRVVQCSDLGLDKVPWDFPPDTTLLDLQNNKITEIKEGAFKNLKDLHTLILVNNKISKISPEAFKPLVKLERLYLSKNQLKELPEKMPRTLQELRVHENEITKLRKSDFNGLNNVLVIELGGNPLKNSGIENGAFQGLKSLSYIRISDTNITAIPQGLPTSLTEVHLDGNKITKVDAPSLKGLINLSKLGLSFNSITVMENGSLANVPHLRELHLDNNKLLRVPAGLAQHKYIQVVYLHNNNISAVGQNDFCRAGHPSRKASYSAVSLYGNPVRYWEIFPNTFRCVYVRSAIQLGNYK
Sequence Length
354
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

SDS-Page
Related Product Information for Dcn recombinant protein
May affect the rate of fibrils formation.
References
Naitoh Y., Suzuki S. The murine decorin. Complete cDNA cloning, genomic organization, chromosomal assignment, and expression during organogenesis and tissue differentiation.Scholzen T., Solursh M., Suzuki S., Reiter R., Morgan J.L., Buchberg A.M., Siracusa L.D., Iozzo R.V.J. Biol. Chem. 269:28270-28281(1994)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37.9 kDa
NCBI Official Full Name
decorin preproprotein
NCBI Official Synonym Full Names
decorin
NCBI Official Symbol
Dcn
NCBI Official Synonym Symbols
DC; PG40; PGII; PGS2; DSPG2; SLRR1B
NCBI Protein Information
decorin
UniProt Protein Name
Decorin
Protein Family
UniProt Gene Name
Dcn
UniProt Entry Name
PGS2_MOUSE

NCBI Description

This gene encodes a member of the small leucine-rich proteoglycan (SLRP) family of proteins. The encoded preproprotein is proteolytically processed to generate a mature protein product, which is secreted into the extracellular space to regulate collagen fibril assembly. Homozygous knockout mice for this gene exhibit enhanced tumorigenesis in a liver cancer model, and defects in collagen fibrils, leading to weakened skin and tendons. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2015]

Uniprot Description

DCN: May affect the rate of fibrils formation. Defects in DCN are the cause of congenital stromal corneal dystrophy (CSCD). Corneal dystrophies are inherited, bilateral, primary alterations of the cornea that are not associated with prior inflammation or secondary to systemic disease. Most show autosomal dominant inheritance. Belongs to the small leucine-rich proteoglycan (SLRP) family. SLRP class I subfamily. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide; Extracellular matrix; Motility/polarity/chemotaxis

Cellular Component: collagen type VI; cytoplasm; extracellular matrix; extracellular region; extracellular space; proteinaceous extracellular matrix

Molecular Function: collagen binding; extracellular matrix binding; glycosaminoglycan binding; protein kinase inhibitor activity; protein N-terminus binding

Biological Process: cytokine and chemokine mediated signaling pathway; negative regulation of angiogenesis; negative regulation of JAK-STAT cascade; negative regulation of protein kinase activity; peptide cross-linking via chondroitin 4-sulfate glycosaminoglycan; positive regulation of autophagy; positive regulation of macroautophagy; positive regulation of mitochondrial depolarization; positive regulation of phosphoinositide 3-kinase cascade; positive regulation of transcription from RNA polymerase II promoter

Research Articles on Dcn

Similar Products

Product Notes

The Dcn dcn (Catalog #AAA961085) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 35-354aa; Partial. The amino acid sequence is listed below: GIIPYDPDNP LISMCPYRCQ CHLRVVQCSD LGLDKVPWDF PPDTTLLDLQ NNKITEIKEG AFKNLKDLHT LILVNNKISK ISPEAFKPLV KLERLYLSKN QLKELPEKMP RTLQELRVHE NEITKLRKSD FNGLNNVLVI ELGGNPLKNS GIENGAFQGL KSLSYIRISD TNITAIPQGL PTSLTEVHLD GNKITKVDAP SLKGLINLSK LGLSFNSITV MENGSLANVP HLRELHLDNN KLLRVPAGLA QHKYIQVVYL HNNNISAVGQ NDFCRAGHPS RKASYSAVSL YGNPVRYWEI FPNTFRCVYV RSAIQLGNYK. It is sometimes possible for the material contained within the vial of "Decorin, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.