Acyl-CoA-binding protein Recombinant Protein | DBI recombinant protein

Recombinant Human Acyl-CoA-binding protein

Cat. Num. AAA949699

• Gene Names: DBI; EP; ACBP; ACBD1; CCK-RP
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Acyl-CoA-binding protein; Recombinant Human Acyl-CoA-binding protein; Diazepam-binding inhibitor; DBI; Endozepine; EP; DBI recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-104aa; Full Length of Mature Protein of Isoform 2
• Sequence: WGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI
• Sequence Length: 87

• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for DBI recombinant protein

Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor.

Product Categories/Family for DBI recombinant protein

Transport

References

Cloning and expression of cDNA for human diazepam binding inhibitor, a natural ligand of an allosteric regulatory site of the gamma-aminobutyric acid type A receptor.Gray P.W., Glaister D., Seeburg P.H., Guidotti A., Costa E.Proc. Natl. Acad. Sci. U.S.A. 83:7547-7551(1986)

NCBI and Uniprot Product Information

• NCBI GI #: 120433590
• NCBI GeneID: 1622
• NCBI Accession #: NP_001073331.1
• NCBI GenBank Nucleotide #: NM_001079862.2
• UniProt Accession #: P07108; P08869; Q4VWZ6; Q53SQ7; Q6IB48; Q9UCI8; B8ZWD2; B8ZWD6; B8ZWD7
• Molecular Weight: 15.7 kDa
• NCBI Official Full Name: acyl-CoA-binding protein isoform 3
• NCBI Official Synonym Full Names: diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein)
• NCBI Official Symbol: DBI
• NCBI Official Synonym Symbols: EP; ACBP; ACBD1; CCK-RP
• NCBI Protein Information: acyl-CoA-binding protein
• UniProt Protein Name: Acyl-CoA-binding protein
• Protein Family: Acyl-CoA-binding protein
• UniProt Gene Name: DBI
• UniProt Synonym Gene Names: ACBP; DBI; EP
• UniProt Entry Name: ACBP_HUMAN

NCBI Description

This gene encodes diazepam binding inhibitor, a protein that is regulated by hormones and is involved in lipid metabolism and the displacement of beta-carbolines and benzodiazepines, which modulate signal transduction at type A gamma-aminobutyric acid receptors located in brain synapses. The protein is conserved from yeast to mammals, with the most highly conserved domain consisting of seven contiguous residues that constitute the hydrophobic binding site for medium- and long-chain acyl-Coenzyme A esters. Diazepam binding inhibitor is also known to mediate the feedback regulation of pancreatic secretion and the postprandial release of cholecystokinin, in addition to its role as a mediator in corticotropin-dependent adrenal steroidogenesis. Three pseudogenes located on chromosomes 6, 8 and 16 have been identified. Multiple transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor.