Lanosterol 14-alpha demethylase (Cyp51a1) Recombinant Protein | Cyp51a1 recombinant protein
Recombinant Mouse Lanosterol 14-alpha demethylase (Cyp51a1)
Gene Names
Cyp51; Ldm; CYPLI; P450LI; Cyp51a1; AI426508; P450-14DM
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Lanosterol 14-alpha demethylase (Cyp51a1); Recombinant Mouse Lanosterol 14-alpha demethylase (Cyp51a1); Cyp51a1 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-503aa; full length protein
Sequence
MVLLGLLQSGGWVLGQAMEQVTGGNLLSTLLIACAFTLSLVYLFRLAVGHMVQLPAGAKS PPHIYSPIPFLGHAIAFGKSPIEFLENAYEKYGPVFSFTMVGKTFTYLLGSDAAALLFNS KNEDLNAEEVYGRLTTPVFGKGVAYDVPNAIFLEQKKIIKSGLNIAHFKQYVPIIEKEAK EYFQSWGESGERNVFEALSELIILTASHCLHGKEIRSQLNEKVAQLYADLDGGFTHAAWL LPAWLPLPSFRRRDRAHREIKNIFYKAIQKRRLSKEPAEDILQTLLDSTYKDGRPLTDEE ISGMLIGLLLAGQHTSSTTSAWMGFFLAKDKPLQEKCYLEQKAVCGEDLPPLTYDQLKDL NLLDRCIKETLRLRPPIMTMMRMAKTPQTVAGYTIPPGHQVCVSPTVNQRLKDSWAERLD FNPDRYLQDNPASGEKFAYVPFGAGRHRCVGENFAYVQIKTIWSTMLRLYEFDLINGYFP TVNYTTMIHTPENPVIRYKRRSK
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Cyp51a1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
56,776 Da
NCBI Official Full Name
lanosterol 14-alpha demethylase
NCBI Official Synonym Full Names
cytochrome P450, family 51
NCBI Official Symbol
Cyp51
NCBI Official Synonym Symbols
Ldm; CYPLI; P450LI; Cyp51a1; AI426508; P450-14DM
NCBI Protein Information
lanosterol 14-alpha demethylase
UniProt Protein Name
Lanosterol 14-alpha demethylase
UniProt Gene Name
Cyp51a1
UniProt Synonym Gene Names
Cyp51; LDM; Cytochrome P45014DM
UniProt Entry Name
CP51A_MOUSE
Uniprot Description
CYP51A1: Catalyzes C14-demethylation of lanosterol; it transforms lanosterol into 4,4'-dimethyl cholesta-8,14,24-triene-3-beta-ol. Belongs to the cytochrome P450 family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Lipid Metabolism - steroid biosynthesis; Membrane protein, integral; EC 1.14.13.70; Oxidoreductase
Cellular Component: endoplasmic reticulum; integral to membrane; intracellular membrane-bound organelle; membrane; plasma membrane
Molecular Function: heme binding; iron ion binding; metal ion binding; monooxygenase activity; oxidoreductase activity; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen; sterol 14-demethylase activity
Biological Process: cholesterol biosynthetic process; cholesterol biosynthetic process via 24,25-dihydrolanosterol; cholesterol metabolic process; lipid metabolic process; steroid biosynthetic process; steroid metabolic process; sterol biosynthetic process
Research Articles on Cyp51a1
Similar Products
Product Notes
The Cyp51a1 cyp51a1 (Catalog #AAA7013476) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-503aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Cyp51a1 cyp51a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MVLLGLLQSG GWVLGQAMEQ VTGGNLLSTL LIACAFTLSL VYLFRLAVGH MVQLPAGAKS PPHIYSPIPF LGHAIAFGKS PIEFLENAYE KYGPVFSFTM VGKTFTYLLG SDAAALLFNS KNEDLNAEEV YGRLTTPVFG KGVAYDVPNA IFLEQKKIIK SGLNIAHFKQ YVPIIEKEAK EYFQSWGESG ERNVFEALSE LIILTASHCL HGKEIRSQLN EKVAQLYADL DGGFTHAAWL LPAWLPLPSF RRRDRAHREI KNIFYKAIQK RRLSKEPAED ILQTLLDSTY KDGRPLTDEE ISGMLIGLLL AGQHTSSTTS AWMGFFLAKD KPLQEKCYLE QKAVCGEDLP PLTYDQLKDL NLLDRCIKET LRLRPPIMTM MRMAKTPQTV AGYTIPPGHQ VCVSPTVNQR LKDSWAERLD FNPDRYLQDN PASGEKFAYV PFGAGRHRCV GENFAYVQIK TIWSTMLRLY EFDLINGYFP TVNYTTMIHT PENPVIRYKR RSK. It is sometimes possible for the material contained within the vial of "Lanosterol 14-alpha demethylase (Cyp51a1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
