1,25-dihydroxyvitamin D (3) 24-hydroxylase, mitochondrial (Cyp24a1) Recombinant Protein | Cyp24a1 recombinant protein
Recombinant Mouse 1,25-dihydroxyvitamin D (3) 24-hydroxylase, mitochondrial (Cyp24a1)
Gene Names
Cyp24a1; CP24; Cyp24; 24-OHase
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
1; 25-dihydroxyvitamin D (3) 24-hydroxylase; mitochondrial (Cyp24a1); Recombinant Mouse 1; Cyp24a1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
36-514, full length protein
Sequence
RAPKEVPLCPLMTDGETRNVTSLPGPTNWPLLGSLLEIFWKGGLKKQHDTLAEYHKKYGQIFRMKLGSFDSVHLGSPSLLEALYRTESAHPQRLEIKPWKAYRDHRNEAYGLMILEGQEWQRVRSAFQKKLMKPVEIMKLDKKINEVLADFMGQIDELRDERGRIQDLYSELNKWSFESICLVLYEKRFGLLQKDTEEEALTFIAAIKTMMSTFGKMMVTPVELHKRLNTKVWQAHTLAWDTIFKSVKPCIDHRLERYSQQPGADFLCDIYQQDHLSKKELYAAVTELQLAAVETTANSLMWILYNLSRNPQVQQRLLREIQSVLPDNQTPRAEDVRNMPYLKACLKESMRLTPSVPFTTRTLDKPTVLGEYTLPKGTVLTLNTQVLGSSEDNFEDADKFRPERWLEKEKKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIIQKYNIVATDSEPVEMLHLGILVPSRELPIAFCPR
Sequence Length
479
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Cyp24a1 recombinant protein
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein initiates the degradation of 1,25-dihydroxyvitamin D3, the physiologically active form of vitamin D3, by hydroxylation of the side chain. In regulating the level of vitamin D3, this enzyme plays a role in calcium homeostasis and the vitamin D endocrine system. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59,453 Da
NCBI Official Full Name
1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial
NCBI Official Synonym Full Names
cytochrome P450, family 24, subfamily a, polypeptide 1
NCBI Official Symbol
Cyp24a1
NCBI Official Synonym Symbols
CP24; Cyp24; 24-OHase
NCBI Protein Information
1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial
UniProt Protein Name
1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial
Protein Family
UniProt Gene Name
Cyp24a1
UniProt Synonym Gene Names
Cyp-24; Cyp24; 24-OHase; Vitamin D(3) 24-hydroxylase
NCBI Description
The protein encoded by this gene localizes to the mitochondrion, where it degrades calcitriol to calcitetrol. This gene is upregulated by binding of calcitriol to the upstream regulatory region and to a downstream enhancer region, thereby allowing calcitriol to autoregulate its concentration in the cell. The encoded protein may also play a role in calcium homeostasis. [provided by RefSeq, Aug 2015]
Uniprot Description
Has a role in maintaining calcium homeostasis. Catalyzes the adrenodoxin-dependent 24-hydroxylation of calcidiol (25-hydroxyvitamin D3) and calcitriol (1-alpha,25-dihydroxyvitamin D3). The enzyme can perform up to 6 rounds of hydroxylation of calcitriol leading to calcitroic acid.
Research Articles on Cyp24a1
Similar Products
Product Notes
The Cyp24a1 cyp24a1 (Catalog #AAA1485620) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 36-514, full length protein. The amino acid sequence is listed below: RAPKEVPLCP LMTDGETRNV TSLPGPTNWP LLGSLLEIFW KGGLKKQHDT LAEYHKKYGQ IFRMKLGSFD SVHLGSPSLL EALYRTESAH PQRLEIKPWK AYRDHRNEAY GLMILEGQEW QRVRSAFQKK LMKPVEIMKL DKKINEVLAD FMGQIDELRD ERGRIQDLYS ELNKWSFESI CLVLYEKRFG LLQKDTEEEA LTFIAAIKTM MSTFGKMMVT PVELHKRLNT KVWQAHTLAW DTIFKSVKPC IDHRLERYSQ QPGADFLCDI YQQDHLSKKE LYAAVTELQL AAVETTANSL MWILYNLSRN PQVQQRLLRE IQSVLPDNQT PRAEDVRNMP YLKACLKESM RLTPSVPFTT RTLDKPTVLG EYTLPKGTVL TLNTQVLGSS EDNFEDADKF RPERWLEKEK KINPFAHLPF GVGKRMCIGR RLAELQLHLA LCWIIQKYNI VATDSEPVEM LHLGILVPSR ELPIAFCPR. It is sometimes possible for the material contained within the vial of "1,25-dihydroxyvitamin D (3) 24-hydroxylase, mitochondrial (Cyp24a1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
