Cytochrome c1, heme protein, mitochondrial (CYC1) Recombinant Protein | CYC1 recombinant protein
Recombinant Bovine Cytochrome c1, heme protein, mitochondrial (CYC1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cytochrome c1; heme protein; mitochondrial (CYC1); Recombinant Bovine Cytochrome c1; CYC1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
85-325
Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Sequence Length
325
Species
Bos taurus (Bovine)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Related Product Information for CYC1 recombinant protein
CYC1
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
35,297 Da
NCBI Official Full Name
cytochrome c1, heme protein, mitochondrial
NCBI Official Synonym Full Names
cytochrome c-1
NCBI Official Symbol
CYC1
NCBI Protein Information
cytochrome c1, heme protein, mitochondrial; complex III subunit 4; complex III subunit IV; cytochrome b-c1 complex subunit 4; ubiquinol-cytochrome-c reductase complex cytochrome c1 subunit
UniProt Protein Name
Cytochrome c1, heme protein, mitochondrial
Protein Family
UniProt Gene Name
CYC1
UniProt Synonym Gene Names
Cytochrome c-1
UniProt Entry Name
CY1_BOVIN
Uniprot Description
CYC1: This is the heme-containing component of the cytochrome b-c1 complex, which accepts electrons from Rieske protein and transfers electrons to cytochrome c in the mitochondrial respiratory chain. Belongs to the cytochrome c family.
Protein type: Oxidoreductase; Mitochondrial; Membrane protein, integral; Energy Metabolism - oxidative phosphorylation
Cellular Component: mitochondrion; mitochondrial inner membrane; integral to membrane; nucleus
Molecular Function: electron carrier activity; iron ion binding; heme binding
Research Articles on CYC1
Similar Products
Product Notes
The CYC1 cyc1 (Catalog #AAA952749) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 85-325. The amino acid sequence is listed below: SDLELHPPSY PWSHRGLLSS LDHTSIRRGF QVYKQVCSSC HSMDYVAYRH LVGVCYTEDE AKALAEEVEV QDGPNEDGEM FMRPGKLSDY FPKPYPNPEA ARAANNGALP PDLSYIVRAR HGGEDYVFSL LTGYCEPPTG VSLREGLYFN PYFPGQAIGM APPIYNEVLE FDDGTPATMS QVAKDVCTFL RWAAEPEHDH RKRMGLKMLL MMGLLLPLVY AMKRHKWSVL KSRKLAYRPP K. It is sometimes possible for the material contained within the vial of "Cytochrome c1, heme protein, mitochondrial (CYC1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
