Protein CyaY (cyaY) Recombinant Protein | cyaY recombinant protein

Recombinant Escherichia coli Protein CyaY (cyaY)

Cat. Num. AAA1227758

• Gene Names: cyaY; ECK3801; JW3779
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Protein CyaY (cyaY); Recombinant Escherichia coli Protein CyaY (cyaY); cyaY recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-106, full length protein
• Sequence: MNDSEFHRLADQLWLTIEERLDDWDGDSDIDCEINGGVLTITFENGSKIIINRQEPLHQVWLATKQGGYHFDLKGDEWICDRSGETFWDLLEQAATQQAGETVSFR
• Sequence Length: 106

• Species: Escherichia coli (strain K12)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 16131659
• NCBI GeneID: 947754
• NCBI Accession #: NP_418251.1
• NCBI GenBank Nucleotide #: NC_000913.3
• UniProt Accession #: P27838; Q2M8B2
• Molecular Weight: 12,231 Da
• NCBI Official Full Name: iron-dependent inhibitor of iron-sulfur cluster formation; frataxin; iron-binding and oxidizing protein
• NCBI Official Symbol: cyaY
• NCBI Official Synonym Symbols: ECK3801; JW3779
• NCBI Protein Information: iron-dependent inhibitor of iron-sulfur cluster formation; frataxin; iron-binding and oxidizing protein
• UniProt Protein Name: Iron-sulfur cluster assembly protein CyaY
• Protein Family: Protein
• UniProt Gene Name: cyaY

NCBI Description

Frataxin-related. [More information is available at EcoGene: EG11653]. CyaY is a protein with similarity to human frataxin, mutations in which are responsible for Friedreich's ataxia. [More information is available at EcoCyc: EG11653].

Uniprot Description

Involved in iron-sulfur (Fe-S) cluster assembly (PubMed:16603772, PubMed:19305405, PubMed:21799759, PubMed:25430730). May act as a regulator of Fe-S biogenesis (PubMed:19305405, PubMed:21799759, PubMed:25430730). Can bind both Fe2+ and Fe3+ ions (PubMed:15530368, PubMed:16603772, PubMed:17244611, PubMed:17651435). In vivo, has a positive effect on Fe-S cluster biogenesis under iron-rich growth conditions (PubMed:25430730). In vitro, can inhibit IscS cysteine desulfurase activity and the formation of Fe-S clusters on IscU (PubMed:19305405, PubMed:21799759). In vitro, in the presence of IscS and cysteine, Fe3+-CyaY can be used as an iron donor during Fe-S cluster assembly on the scaffold protein IscU (PubMed:16603772).