C-X-C chemokine receptor type 7 (CXCR7) Recombinant Protein | CXCR7 recombinant protein

Recombinant Dog C-X-C chemokine receptor type 7 (CXCR7)

• Gene Names: CXCR7; RDC1; CMKOR1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: C-X-C chemokine receptor type 7 (CXCR7); Recombinant Dog C-X-C chemokine receptor type 7 (CXCR7); Recombinant C-X-C chemokine receptor type 7 (CXCR7); C-X-C chemokine receptor type 7; CXC-R7; CXCR-7; Chemokine orphan receptor 1 G-protein coupled receptor RDC1; RDC-1; CXCR7 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-362
• Sequence: MDLHLFDYAEPGNFSDISWPCNSSDCIVVDTVLCPNMPNKSVLLYTLSFIYIFIFVIGMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVVTIPVWVVSLVQHNQWPMGELTCKITHLIFSINLFGSIFFLTCMSVDRYLSITYFASTSSRRKKVVRRAVCVLVWLLAFCVSLPDTYYLKTVTSASNNETYCRSFYPEHSVKEWLISMELVSVVLGFAIPFCVIAVFYCLLARAISASSDQEKQSSRKIIFSYVVVFLVCWLPYHVVVLLDIFSILHYIPFTCQLENFLFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQNAK
• Sequence Length: 362

• Species: Canis familiaris (Dog) (Canis lupus familiaris)
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

• NCBI GI #: 50979088
• NCBI GeneID: 403964
• NCBI Accession #: NP_001003281.1
• NCBI GenBank Nucleotide #: NM_001003281.2
• UniProt Accession #: P11613
• Molecular Weight: 41,416 Da
• NCBI Official Full Name: C-X-C chemokine receptor type 7
• NCBI Official Symbol: CXCR7
• NCBI Official Synonym Symbols: RDC1; CMKOR1
• NCBI Protein Information: C-X-C chemokine receptor type 7; RDC-1; CXC-R7; CXCR-7; chemokine orphan receptor 1; G-protein coupled receptor RDC1
• UniProt Protein Name: C-X-C chemokine receptor type 7
• UniProt Gene Name: CXCR7
• UniProt Synonym Gene Names: CMKOR1; RDC1; CXC-R7; CXCR-7; RDC-1
• UniProt Entry Name: CXCR7_CANFA

Uniprot Description

Function: Receptor for chemokines CXCL12/SDF1 and CXCL11. Does not elicit classical chemokine receptor signaling; chemokine binding does not activate G-protein-mediated signal transduction but instead induces beta-arrestin recruitment, leading to ligand internalization and activation of MAPK signaling pathway. Acts as a scavenger for CXCL12/SDF1 and, to a lesser extent, for CXCL11. Required for regulation of CXCR4 protein levels in migrating interneurons, thereby adapting their chemokine responsiveness. In glioma cells, transduces signals via MEK/ERK pathway, mediating resistance to apoptosis. Promotes cell growth and survival. Not involved in cell migration, adhesion or proliferation of normal hematopoietic progenitors but activated by CXCL11 in malignant hemapoietic cells, leading to phosphorylation of ERK1/2 (MAPK3/MAPK1) and enhanced cell adhesion and migration. Plays a regulatory role in CXCR4-mediated activation of cell surface integrins by CXCL12. Required for heart valve development

By similarity.

Subunit structure: Homodimer. Can form heterodimers with CXCR4; heterodimerization may regulate CXCR4 signaling activity

By similarity.

Subcellular location: Cell membrane; Multi-pass membrane protein. Cytoplasm › perinuclear region

By similarity. Early endosome

By similarity. Recycling endosome

By similarity. Note: Localized mainly in perinuclear regions in neurons and in early endosomes in T-lymphocytes and some other cell types, with very low levels detected on the cell surface. May spontaneously cycle between the plasma membrane and endosomal compartments

By similarity.

Sequence similarities: Belongs to the G-protein coupled receptor 1 family.