Atypical chemokine receptor 3 Recombinant Protein | ACKR3 recombinant protein

Recombinant Human Atypical chemokine receptor 3

Cat. Num. AAA968533

• Gene Names: ACKR3; RDC1; CXCR7; RDC-1; CMKOR1; CXC-R7; CXCR-7; GPR159
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Atypical chemokine receptor 3; Recombinant Human Atypical chemokine receptor 3; C-X-C chemokine receptor type 7; CXC-R7; CXCR-7; Chemokine orphan receptor 1; G-protein coupled receptor 159; G-protein coupled receptor RDC1 homolog; RDC-1; ACKR3 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-40aa; Partial
• Sequence: MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNK

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for ACKR3 recombinant protein

Atypical chemokine receptor that controls chemokine levels and localization via high-affinity chemokine binding that is uncoupled from classic ligand-driven signal transduction cascades, resulting instead in chemokine sequestration, degradation, or transcytosis. Also known as interceptor (internalizing receptor) or chemokine-scavenging receptor or chemokine decoy receptor. Acts as a receptor for chemokines CXCL11 and CXCL12/SDF1. Chemokine binding does not activate G-protein-mediated signal transduction but instead induces beta-arrestin recruitment, leading to ligand internalization and activation of MAPK signaling pathway. Required for regulation of CXCR4 protein levels in migrating interneurons, thereby adapting their chemokine responsiveness. In glioma cells, transduces signals via MEK/ERK pathway, mediating resistance to apoptosis. Promotes cell growth and survival. Not involved in cell migration, adhesion or proliferation of normal hematopoietic progenitors but activated by CXCL11 in malignant hemapoietic cells, leading to phosphorylation of ERK1/2 (MAPK3/MAPK1) and enhanced cell adhesion and migration. Plays a regulatory role in CXCR4-mediated activation of cell surface integrins by CXCL12. Required for heart valve development. Acts as coreceptor with CXCR4 for a restricted number of HIV isolates.

Product Categories/Family for ACKR3 recombinant protein

Signal Transduction

References

"Cloning and expression of the human vasoactive intestinal peptide receptor." Sreedharan S.P., Robichon A., Peterson K.E., Goetzl E.J. Proc. Natl. Acad. Sci. U.S.A. 88:4986-4990(1991)

NCBI and Uniprot Product Information

• NCBI GI #: 31083344
• NCBI GeneID: 57007
• NCBI Accession #: NP_064707.1
• NCBI GenBank Nucleotide #: NM_020311.2
• UniProt Accession #: P25106; Q53RV4; Q8NE10; Q92938; Q92986; A8K6J4
• Molecular Weight: 20.5 kDa
• NCBI Official Full Name: atypical chemokine receptor 3
• NCBI Official Synonym Full Names: atypical chemokine receptor 3
• NCBI Official Symbol: ACKR3
• NCBI Official Synonym Symbols: RDC1; CXCR7; RDC-1; CMKOR1; CXC-R7; CXCR-7; GPR159
• NCBI Protein Information: atypical chemokine receptor 3
• UniProt Protein Name: Atypical chemokine receptor 3
• Protein Family: Atypical chemokine receptor
• UniProt Gene Name: ACKR3
• UniProt Synonym Gene Names: CMKOR1; CXCR7; GPR159; RDC1; CXC-R7; CXCR-7; RDC-1
• UniProt Entry Name: ACKR3_HUMAN

NCBI Description

This gene encodes a member of the G-protein coupled receptor family. Although this protein was earlier thought to be a receptor for vasoactive intestinal peptide (VIP), it is now considered to be an orphan receptor, in that its endogenous ligand has not been identified. The protein is also a coreceptor for human immunodeficiency viruses (HIV). Translocations involving this gene and HMGA2 on chromosome 12 have been observed in lipomas. [provided by RefSeq, Jul 2008]

Uniprot Description

CMKOR1: Receptor for chemokines CXCL12/SDF1 and CXCL11. Does not elicit classical chemokine receptor signaling; chemokine binding does not activate G-protein-mediated signal transduction but instead induces beta-arrestin recruitment, leading to ligand internalization and activation of MAPK signaling pathway. Acts as a scavenger for CXCL12/SDF1 and, to a lesser extent, for CXCL11. Required for regulation of CXCR4 protein levels in migrating interneurons, thereby adapting their chemokine responsiveness. In glioma cells, transduces signals via MEK/ERK pathway, mediating resistance to apoptosis. Promotes cell growth and survival. Not involved in cell migration, adhesion or proliferation of normal hematopoietic progenitors but activated by CXCL11 in malignant hemapoietic cells, leading to phosphorylation of ERK1/2 (MAPK3/MAPK1) and enhanced cell adhesion and migration. Plays a regulatory role in CXCR4-mediated activation of cell surface integrins by CXCL12. Required for heart valve development. Acts as coreceptor with CXCR4 for a restricted number of HIV isolates. Belongs to the G-protein coupled receptor 1 family.

Protein type: Receptor, GPCR; Membrane protein, multi-pass; Membrane protein, integral; GPCR, family 1

Chromosomal Location of Human Ortholog: 2q37.3

Cellular Component: cell surface; coated pit; early endosome; endosome; integral to membrane; intracellular membrane-bound organelle; perinuclear region of cytoplasm; plasma membrane; recycling endosome

Molecular Function: C-X-C chemokine binding; C-X-C chemokine receptor activity; coreceptor activity; protein binding; scavenger receptor activity

Biological Process: angiogenesis; cell adhesion; chemotaxis; G-protein coupled receptor protein signaling pathway; positive regulation of defense response to virus by host; receptor internalization; vasculogenesis; viral reproduction