Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

C-X-C chemokine receptor type 4 (CXCR4) Recombinant Protein | CXCR4 recombinant protein

Recombinant Pan troglodytes C-X-C chemokine receptor type 4 (CXCR4)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
C-X-C chemokine receptor type 4 (CXCR4); Recombinant Pan troglodytes C-X-C chemokine receptor type 4 (CXCR4); Recombinant C-X-C chemokine receptor type 4 (CXCR4); C-X-C chemokine receptor type 4; CXC-R4; CXCR-4; Fusin Stromal cell-derived factor 1 receptor; SDF-1 receptor CD_antigen= CD184; CXCR4 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-38aa; Fragment at the N-terminal, provide the extracellular domain, include the region (1-21) Important for chemokine binding and signaling.
Sequence
MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNK
Species
Pan troglodytes (Chimpanzee)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,746 Da
NCBI Official Full Name
C-X-C chemokine receptor type 4
NCBI Official Symbol
CXCR4
NCBI Protein Information
C-X-C chemokine receptor type 4; fusin; CXC-R4; CXCR-4; SDF-1 receptor; CXC chemokine receptor 4; stromal cell-derived factor 1 receptor
UniProt Protein Name
C-X-C chemokine receptor type 4
Protein Family
UniProt Gene Name
CXCR4
UniProt Synonym Gene Names
CXC-R4; CXCR-4
UniProt Entry Name
CXCR4_PANTR

Uniprot Description

CXCR4: Receptor for the C-X-C chemokine CXCL12/SDF-1 that transduces a signal by increasing intracellular calcium ion levels and enhancing MAPK1/MAPK3 activation. Acts as a receptor for extracellular ubiquitin; leading to enhanced intracellular calcium ions and reduced cellular cAMP levels. Involved in hematopoiesis and in cardiac ventricular septum formation. Also plays an essential role in vascularization of the gastrointestinal tract, probably by regulating vascular branching and/or remodeling processes in endothelial cells. Involved in cerebellar development. In the CNS, could mediate hippocampal-neuron survival. Acts as a coreceptor (CD4 being the primary receptor) for HIV-1 X4 isolates and as a primary receptor for some HIV-2 isolates. Promotes Env-mediated fusion of the virus. Monomer. Can form dimers. Interacts with CD164. Interacts with HIV-1 surface protein gp120 and Tat. Interacts with ARRB2; the interaction is dependent on the C-terminal phosphorylation of CXCR4 and allows activation of MAPK1 and MAPK3. Interacts with ARRC; the interaction is dependent on the C-terminal phosphorylation of CXCR4 and modulates calcium mobilization. Interacts (via the cytoplasmic C-terminal) with ITCH (via the WW domains I and II); the interaction, enhanced by CXCL12, ubiquitinates CXCR4 and leads to its degradation. Interacts with extracellular ubiquitin. Interacts with human cytomegalovirus/HHV- 5 protein UL78. Expressed in numerous tissues, such as peripheral blood leukocytes, spleen, thymus, spinal cord, heart, placenta, lung, liver, skeletal muscle, kidney, pancreas, cerebellum, cerebral cortex and medulla (in microglia as well as in astrocytes), brain microvascular, coronary artery and umbilical cord endothelial cells. Isoform 1 is predominant in all tissues tested. Belongs to the G-protein coupled receptor 1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, GPCR; Membrane protein, multi-pass; Membrane protein, integral; GPCR, family 1

Chromosomal Location of Human Ortholog: 2q21

Cellular Component: cell surface; lysosome; cytoplasmic membrane-bound vesicle; early endosome; leading edge; integral to membrane; intercellular junction; growth cone; cytoplasm; late endosome; plasma membrane; cytoplasmic vesicle; external side of plasma membrane

Molecular Function: G-protein coupled receptor activity; viral receptor activity; ubiquitin binding; protein binding; cytokine binding; ubiquitin protein ligase binding; coreceptor activity; myosin light chain binding; actin binding; C-X-C chemokine receptor activity

Biological Process: entry of virus into host cell; regulation of chemotaxis; viral reproduction; apoptosis; activation of MAPK activity; neuron migration; motor axon guidance; regulation of cell migration; germ cell development; T cell proliferation; elevation of cytosolic calcium ion concentration; germ cell migration; dendritic cell chemotaxis; positive regulation of oligodendrocyte differentiation; inflammatory response; neutrophil activation; response to virus; calcium-mediated signaling; patterning of blood vessels; G-protein coupled receptor protein signaling pathway; ameboidal cell migration; myelin maintenance; response to hypoxia; entry into host cell; brain development

Disease: Whim Syndrome

Similar Products

Product Notes

The CXCR4 cxcr4 (Catalog #AAA1235532) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-38aa; Fragment at the N-terminal, provide the extracellular domain, include the region (1-21) Important for chemokine binding and signaling. The amino acid sequence is listed below: MEGISIYTSD NYTEEMGSGD YDSMKEPCFR EENANFNK. It is sometimes possible for the material contained within the vial of "C-X-C chemokine receptor type 4 (CXCR4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.