Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) ()

CXCL5 recombinant protein

CXCL5 protein (His tag)

Applications
ELISA, SDS-Page, Western Blot
Purity
> 90% pure
Synonyms
CXCL5; CXCL5 protein (His tag); ENA 78(1 78) protein; Epithelial derived neutrophil activating 78 protein; Neutrophil activating peptide ENA 78 protein; Small inducible cytokine B5 protein; C X C motif chemokine 5 protein; CXCL 5 protein; CXCL-5 protein; CXCL5 recombinant protein
Ordering
For Research Use Only!
Host
Human
Purity/Purification
> 90% pure
Form/Format
Supplied in liquid form in 6M guanidine hydrochloride and 20mM Tris buffer
Sequence
MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFA  IGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN  
Applicable Applications for CXCL5 recombinant protein
ELISA (EIA), SDS-PAGE, Western Blot (WB)
Source Note
His-fusion expressed in cell supernatent (soluble under denaturing conditions)
Protein Type
Recombinant
Biological Significance
CXCL5 plays a role in neutrophil activation.
Expression System
E Coli
Tag/Conjugate
His tag
Preparation and Storage
Store at 4 degree C in a working aliquot for 1 week. For long term storage, aliquot and freeze at -20 to -80 degree C, avoid repeat freeze/thaw cycles

Western Blot (WB)

()

Western Blot (WB) ()
Related Product Information for CXCL5 recombinant protein
Purified recombinant CXCL5 protein (His tag)
Product Categories/Family for CXCL5 recombinant protein

Similar Products

Product Notes

The CXCL5 (Catalog #AAA5303869) is a Recombinant Protein produced from Human and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CXCL5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), SDS-PAGE, Western Blot (WB). Researchers should empirically determine the suitability of the CXCL5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSLLSSRAAR VPGPSSSLCA LLVLLLLLTQ PGPIASAGPA AAVLRELRCV CLQTTQGVHP KMISNLQVFA  IGPQCSKV EVVASLKNGK EICLDPEAPF LKKVIQKILD GGNKEN  . It is sometimes possible for the material contained within the vial of "CXCL5, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.