SDS-PAGE
C-X-C motif chemokine 13 Recombinant Protein | CXCL13 recombinant protein
Recombinant Rat C-X-C motif chemokine 13 protein
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
C-X-C motif chemokine 13; Recombinant Rat C-X-C motif chemokine 13 protein; CXCL13 recombinant protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
23-108aa; Full Length
Sequence
LETHYTNLKCRCSKVSSTFINLILVDWIQVIRPGNGCPKTEIIFWTKAKKAICVNPTARWLPKVLKFVRRSITSTPQAPVSKKRAA
Sequence Length
108
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36.8 kDa
NCBI Official Full Name
C-X-C motif chemokine 13
NCBI Official Synonym Full Names
chemokine (C-X-C motif) ligand 13
NCBI Official Symbol
Cxcl13
NCBI Protein Information
C-X-C motif chemokine 13
UniProt Protein Name
Chemokine (C-X-C motif) ligand 13
Protein Family
UniProt Gene Name
Cxcl13
UniProt Entry Name
Q5I0J6_RAT
Similar Products
Product Notes
The CXCL13 cxcl13 (Catalog #AAA1265120) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-108aa; Full Length. The amino acid sequence is listed below: LETHYTNLKC RCSKVSSTFI NLILVDWIQV IRPGNGCPKT EIIFWTKAKK AICVNPTARW LPKVLKFVRR SITSTPQAPV SKKRAA. It is sometimes possible for the material contained within the vial of "C-X-C motif chemokine 13, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
