Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-P2RX2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

Rabbit P2RX2 Polyclonal Antibody | anti-P2RX2 antibody

P2RX2 antibody - N-terminal region

Gene Names
P2RX2; P2X2; DFNA41
Reactivity
Dog, Horse, Human, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
P2RX2; Polyclonal Antibody; P2RX2 antibody - N-terminal region; anti-P2RX2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Horse, Human, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DGASVSQFLGTMAPNFTILIKNSIHYPKFHFSKGNIADRTDGYLKRCTFH
Sequence Length
399
Applicable Applications for anti-P2RX2 antibody
Western Blot (WB)
Homology
Dog: 79%; Horse: 79%; Human: 100%; Pig: 77%; Rabbit: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human P2RX2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-P2RX2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-P2RX2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)
Related Product Information for anti-P2RX2 antibody
This is a rabbit polyclonal antibody against P2RX2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The product of P2RX2 belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle. The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle. Six transcript variants encoding six distinct isoforms have been identified for this gene.
Product Categories/Family for anti-P2RX2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
P2X purinoceptor 2 isoform J
NCBI Official Synonym Full Names
purinergic receptor P2X 2
NCBI Official Symbol
P2RX2
NCBI Official Synonym Symbols
P2X2; DFNA41
NCBI Protein Information
P2X purinoceptor 2
UniProt Protein Name
P2X purinoceptor 2
Protein Family
UniProt Gene Name
P2RX2
UniProt Synonym Gene Names
P2X2; P2X2
UniProt Entry Name
P2RX2_HUMAN

NCBI Description

The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Aug 2013]

Uniprot Description

P2X2: Binding of this ligand-gated ion channel to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle. Belongs to the P2X receptor family. 7 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Channel, cation; Channel, ligand-gated; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 12q24.33

Cellular Component: apical plasma membrane; integral to nuclear inner membrane; integral to plasma membrane; plasma membrane; receptor complex

Molecular Function: ATP binding; ATP-gated cation channel activity; identical protein binding; ligand-gated ion channel activity; purinergic nucleotide receptor activity

Biological Process: behavioral response to pain; blood coagulation; detection of hypoxic conditions in blood by carotid body chemoreceptors; neuromuscular junction development; neuromuscular synaptic transmission; peristalsis; positive regulation of calcium-mediated signaling; protein homooligomerization; response to ATP; response to carbohydrate stimulus; response to hypoxia; sensory perception of sound; sensory perception of taste; skeletal muscle fiber development; urinary bladder smooth muscle contraction

Disease: Deafness, Autosomal Dominant 41

Research Articles on P2RX2

Similar Products

Product Notes

The P2RX2 p2rx2 (Catalog #AAA3202475) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The P2RX2 antibody - N-terminal region reacts with Dog, Horse, Human, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's P2RX2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the P2RX2 p2rx2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DGASVSQFLG TMAPNFTILI KNSIHYPKFH FSKGNIADRT DGYLKRCTFH. It is sometimes possible for the material contained within the vial of "P2RX2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.