Stromal cell-derived factor 1 Recombinant Protein | Cxcl12 recombinant protein

Recombinant Mouse Stromal cell-derived factor 1 protein

Cat. Num. AAA1265092

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Stromal cell-derived factor 1; Recombinant Mouse Stromal cell-derived factor 1 protein; 12-O-tetradecanoylphorbol 13-acetate repressed protein 1; TPAR1C-X-C motif chemokine 12; Pre-B cell growth-stimulating factor; PBSF; Thymic lymphoma cell-stimulating factor; TLSF; Cxcl12 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 22-89aa; Partial
• Sequence: KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
• Sequence Length: 93

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for Cxcl12 recombinant protein

Choattractant active on T-lymphocytes, monocytes, but not neutrophils. Activates the C-X-C chokine receptor CXCR4 to induce a rapid and transient rise in the level of intracellular calcium ions and chemotaxis. Also binds to atypical chokine receptor ACKR3, which activates the beta-arrestin pathway and acts as a scavenger receptor for SDF-1. Acts as a positive regulator of monocyte migration and a negative regulator of monocyte adhesion via the LYN kinase. Stimulates migration of monocytes and T-lymphocytes through its receptors, CXCR4 and ACKR3, and decreases monocyte adherence to surfaces coated with ICAM-1, a ligand for beta-2 integrins. SDF1A/CXCR4 signaling axis inhibits beta-2 integrin LFA-1 mediated adhesion of monocytes to ICAM-1 through LYN kinase. Plays a protective role after myocardial infarction. Induces down-regulation and internalization of ACKR3 expressed in various cells. Has several critical functions during embryonic development; required for B-cell lymphopoiesis, myelopoiesis in bone marrow and heart ventricular septum formation. Stimulates the proliferation of bone marrow-derived b progenitor cells in the presence of IL-7 as well as growth of the stromal cell-dependent B-cell clone DW34 cells.

References

Signal sequence trap a cloning strategy for secreted proteins and type I membrane proteins.Tashiro K., Tada H., Heilker R., Shirozu M., Nakano T., Honjo T.Science 261:600-603(1993) Molecular cloning of TPAR1, a gene whose expression is repressed by the tumor promoter 12-O-tetradecanoylphorbol 13-acetate (TPA) .Jiang W., Zhou P., Kahn S.M., Tomita N., Johnson M.D., Weinstein I.B.Exp. Cell Res. 215:284-293(1994) Molecular cloning and structure of a pre-B-cell growth-stimulating factor.Nagasawa T., Kikutani H., Kishimoto T.Proc. Natl. Acad. Sci. U.S.A. 91:2305-2309(1994) Nomura M., Nakata Y., Uzawa A., Nose M., Akashi M., Suzuki G. Cloning of mouse full open reading frames in Gateway(R) system entry vector (pDONR201) .Ebert L., Muenstermann E., Schatten R., Henze S., Bohn E., Mollenhauer J., Wiemann S., Schick M., Korn B.Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C. Defects of B-cell lymphopoiesis and bone-marrow myelopoiesis in mice lacking the CXC chemokine PBSF/SDF-1.Nagasawa T., Hirota S., Tachibana K., Takakura N., Nishikawa S., Kitamura Y., Yoshida N., Kikutani H., Kishimoto T.Nature 382:635-638(1996)

NCBI and Uniprot Product Information

• NCBI GI #: 7305465
• NCBI GeneID: 20315
• NCBI Accession #: NP_038683.1
• NCBI GenBank Nucleotide #: NM_013655.4
• UniProt Accession #: P40224; Q4FJL5; Q543V6
• Molecular Weight: 12 kDa
• NCBI Official Full Name: stromal cell-derived factor 1 isoform beta
• UniProt Protein Name: Stromal cell-derived factor 1
• Protein Family: Stromal cell-derived factor
• UniProt Gene Name: Cxcl12
• UniProt Synonym Gene Names: Sdf1; SDF-1; TPAR1; PBSF; TLSF
• UniProt Entry Name: SDF1_MOUSE

Uniprot Description

Chemoattractant active on T-lymphocytes, monocytes, but not neutrophils. Activates the C-X-C chemokine receptor CXCR4 to induce a rapid and transient rise in the level of intracellular calcium ions and chemotaxis. Also binds to atypical chemokine receptor ACKR3, which activates the beta-arrestin pathway and acts as a scavenger receptor for SDF-1. Acts as a positive regulator of monocyte migration and a negative regulator of monocyte adhesion via the LYN kinase. Stimulates migration of monocytes and T-lymphocytes through its receptors, CXCR4 and ACKR3, and decreases monocyte adherence to surfaces coated with ICAM-1, a ligand for beta-2 integrins. SDF1A/CXCR4 signaling axis inhibits beta-2 integrin LFA-1 mediated adhesion of monocytes to ICAM-1 through LYN kinase. Plays a protective role after myocardial infarction. Induces down-regulation and internalization of ACKR3 expressed in various cells (). Has several critical functions during embryonic development; required for B-cell lymphopoiesis, myelopoiesis in bone marrow and heart ventricular septum formation.