C-X-C motif chemokine 10 Recombinant Protein | CXCL10 recombinant protein

Recombinant human C-X-C motif chemokine 10 protein

Cat. Num. AAA717319

• Gene Names: CXCL10; C7; IFI10; INP10; IP-10; crg-2; mob-1; SCYB10; gIP-10
• Applications: SDS-Page, ELISA
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: C-X-C motif chemokine 10; Recombinant human C-X-C motif chemokine 10 protein; C-X-C motif chemokine 10 His tagged; 10 kDa interferon gamma-induced protein; Gamma-IP10; IP-10; Small-inducible cytokine B10; CXCL10 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence: VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP-

• Applicable Applications for CXCL10 recombinant protein: SDS-PAGE, ELISA
• Preparation and Storage: Store working aliquots at 4 degree C for up to one week. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended.

Related Product Information for CXCL10 recombinant protein

Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3.

References

[1] "Gamma-interferon transcriptionally regulates an early-response gene containing homology to platelet proteins." Luster A.D., Unkeless J.C., Ravetch J.V. Nature 315:672-676(1985) [PubMed: 3925348] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA].
[2] "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. Tissue: Prostate.
[3] "Identification of a novel granulocyte chemotactic protein (GCP-2) from human tumor cells. In vitro and in vivo comparison with natural forms of GRO, IP-10, and IL-8." Proost P., de Wolf-Peeters C., Conings R., Opdenakker G., Billiau A., van Damme J. J. Immunol. 150:1000-1010(1993) [PubMed: 8423327] [Abstract] Cited for: PROTEIN SEQUENCE OF 22-51.
[4] "Human IP-9: a keratinocyte derived high affinity CXC-chemokine ligand for the IP-10/Mig receptor (CXCR3)." Tensen C.P., Flier J., van der Raaij-Helmer E.M.H., Sampat-Sardjoepersad S., van der Schors R.C., Leurs R., Scheper R.J., Boorsma D.M., Willemze R. J. Invest. Dermatol. 112:716-722(1999) [PubMed: 10233762] [Abstract] Cited for: PROTEIN SEQUENCE OF 22-29. Tissue: Keratinocyte.
[5] "Processing of natural and recombinant CXCR3-targeting chemokines and implications for biological activity." Hensbergen P.J., van der Raaij-Helmer E.M.H., Dijkman R., van der Schors R.C., Werner-Felmayer G., Boorsma D.M., Scheper R.J., Willemze R., Tensen C.P. Eur. J. Biochem. 268:4992-4999(2001) [PubMed: 11559369] [Abstract] Cited for: PROTEIN SEQUENCE OF 22-27; 60-67 AND 79-98, MASS SPECTROMETRY, IDENTIFICATION OF CXCL10(1-73). Tissue: Foreskin keratinocyte.

NCBI and Uniprot Product Information

• NCBI GI #: 149999382
• NCBI GeneID: 3627
• NCBI Accession #: NP_001556.2
• NCBI GenBank Nucleotide #: NM_001565.3
• UniProt Accession #: P02778; Q96QJ5
• Molecular Weight: 15 kDa
• NCBI Official Full Name: C-X-C motif chemokine 10
• NCBI Official Synonym Full Names: chemokine (C-X-C motif) ligand 10
• NCBI Official Symbol: CXCL10
• NCBI Official Synonym Symbols: C7; IFI10; INP10; IP-10; crg-2; mob-1; SCYB10; gIP-10
• NCBI Protein Information: C-X-C motif chemokine 10; gamma IP10; gamma-IP10; small-inducible cytokine B10; interferon-inducible cytokine IP-10; 10 kDa interferon gamma-induced protein; protein 10 from interferon (gamma)-induced cell line; small inducible cytokine subfamily B (Cys-X-Cys), member 10
• UniProt Protein Name: C-X-C motif chemokine 10
• Protein Family: C-X-C motif chemokine
• UniProt Gene Name: CXCL10
• UniProt Synonym Gene Names: INP10; SCYB10; Gamma-IP10; IP-10
• UniProt Entry Name: CXL10_HUMAN

NCBI Description

This gene encodes a chemokine of the CXC subfamily and ligand for the receptor CXCR3. Binding of this protein to CXCR3 results in pleiotropic effects, including stimulation of monocytes, natural killer and T-cell migration, and modulation of adhesion molecule expression. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3.

Subcellular location: Secreted.

Induction: By IFNG/IFN-gamma. A diverse population of cell types rapidly increases transcription of mRNA encoding this protein. This suggests that gamma-induced protein may be a key mediator of the IFNG/IFN-gamma response.

Post-translational modification: CXCL10(1-73) is produced by proteolytic cleavage after secretion from keratinocytes.

Sequence similarities: Belongs to the intercrine alpha (chemokine CxC) family.

Mass spectrometry: Molecular mass is 8641.8 Da from positions 22 - 98. Determined by ESI. Ref.5