Neutrophil Activating Protein 3 (NAP3) Recombinant Protein | NAP3 recombinant protein

Recombinant Neutrophil Activating Protein 3 (NAP3)

Cat. Num. AAA2012378

• Gene Names: Cxcl1; Gro1; CINC-1
• Applications: SDS-Page, Western Blot, ELISA, Immunoprecipitation
• Purity: > 95%
• Synonyms: Neutrophil Activating Protein 3 (NAP3); Recombinant Neutrophil Activating Protein 3 (NAP3); NAP3 recombinant protein

• Host: E Coli
• Purity/Purification: > 95%
• Form/Format: Supplied as lyophilized form in PBS,pH7.4, containing 5% sucrose, 0.01% sarcosyl.
• Sequence: The target protein is fused with a N-terminal His-tag, its sequence is listed below.; MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-APVANE LRCQCLQTVA GIHFKNIQSL KVMPPGPHCT QTEVIATLKN GREACLDPEA PMVQKIVQKM LKGVPK
• Sequence Length: 96

• Applicable Applications for NAP3 recombinant protein: SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP)
• Organism: Rattus norvegicus (Rat)
• Expression System: Prokaryotic expression
• Residues: Ala25~Lys96 (Accession # P14095) with a N-terminal His-tag
• Endotoxin Level: <1.0EU per 1ug (determined by the LAL method)
• Reconstitution: Reconstitute in sterile PBS, pH7.2-pH7.4.
• Preparation and Storage: Avoid repeated freeze/thaw cycles. Store at 2-8 degree C for one month. Aliquot and store at -80 degree C for 12 months.; Stability Test: The thermal stability is described by the loss rate of the targetprotein. The loss rate was determined by accelerated thermal degradation test,that is, incubate the protein at 37 degree C for 48h, and no obvious degradation andprecipitation were observed. (Referring from China Biological Products Standard,which was calculated by the Arrhenius equation.) The loss of this protein is lessthan 5% within the expiration date under appropriate storage condition.

NCBI and Uniprot Product Information

• NCBI GI #: 13540652
• NCBI GeneID: 81503
• NCBI Accession #: NP_110472.1
• NCBI GenBank Nucleotide #: NM_030845.1
• UniProt Accession #: P14095
• Molecular Weight: 11.6kDa
• NCBI Official Full Name: growth-regulated alpha protein
• NCBI Official Synonym Full Names: chemokine (C-X-C motif) ligand 1
• NCBI Official Symbol: Cxcl1
• NCBI Official Synonym Symbols: Gro1; CINC-1
• NCBI Protein Information: growth-regulated alpha protein; C-X-C motif chemokine 1; cytokine-induced neutrophil chemoattractant 1; platelet-derived growth factor-inducible protein KC; chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha)
• UniProt Protein Name: Growth-regulated alpha protein
• UniProt Gene Name: Cxcl1
• UniProt Synonym Gene Names: Cinc1; Gro; Scyb1; CINC-1
• UniProt Entry Name: GROA_RAT

NCBI Description

acts as a neutrophil chemoattractant; may play a role in acute phase inflammatory response [RGD, Feb 2006]

Uniprot Description

CXCL2: Produced by activated monocytes and neutrophils and expressed at sites of inflammation. Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. GRO-beta(5-73) shows a highly enhanced hematopoietic activity. Belongs to the intercrine alpha (chemokine CxC) family.

Protein type: Motility/polarity/chemotaxis; Secreted, signal peptide; Secreted

Cellular Component: extracellular space

Molecular Function: growth factor activity; chemokine activity; CXCR chemokine receptor binding

Biological Process: neutrophil chemotaxis; response to glucocorticoid stimulus; response to amphetamine; positive regulation of potassium ion transport; positive regulation of leukocyte chemotaxis; response to lipopolysaccharide; response to estradiol stimulus; regulation of cell proliferation; G-protein coupled receptor protein signaling pathway; elevation of cytosolic calcium ion concentration; response to heat; response to molecule of bacterial origin; positive regulation of superoxide release; response to gamma radiation; immune response; acute inflammatory response