Cathepsin O (Ctso) Recombinant Protein | Ctso recombinant protein
Recombinant Mouse Cathepsin O (Ctso)
Gene Names
Ctso; AI118514; A330105D01Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cathepsin O (Ctso); Recombinant Mouse Cathepsin O (Ctso); Ctso recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
99-312, full length protein
Sequence
LPLRFDWRDKHVVNPVRNQEMCGGCWAFSVVSAIESARAIQGKSLDYLSVQQVIDCSFNNSGCLGGSPLCALRWLNETQLKLVADSQYPFKAVNGQCRHFPQSQAGVSVKDFSAYNFRGQEDEMARALLSFGPLVVIVDAMSWQDYLGGIIQHHCSSGEANHAVLITGFDRTGNTPYWMVRNSWGSSWGVEGYAHVKMGGNVCGIADSVAAVFV
Sequence Length
214
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Ctso recombinant protein
The protein encoded by the gene is a cysteine proteinase and a member of the papain superfamily. This proteolytic enzyme is involved in cellular protein degradation and turnover. The recombinant form of this enzyme was shown to degrade synthetic peptides typically used as substrates for cysteine proteinases and its proteolytic activity was abolished by an inhibitor of cyteine proteinase.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
34,723 Da
NCBI Official Full Name
cathepsin O preproprotein
NCBI Official Synonym Full Names
cathepsin O
NCBI Official Symbol
Ctso
NCBI Official Synonym Symbols
AI118514; A330105D01Rik
NCBI Protein Information
cathepsin O
UniProt Protein Name
Cathepsin O
Protein Family
UniProt Gene Name
Ctso
NCBI Description
This gene encodes a member of the cathepsin family of cysteine proteases that are involved in the degradation of cellular proteins. The encoded preproprotein undergoes proteolytic processing to generate a mature, functional enzyme. [provided by RefSeq, Jan 2016]
Uniprot Description
Proteolytic enzyme possibly involved in normal cellular protein degradation and turnover.
Similar Products
Product Notes
The Ctso ctso (Catalog #AAA1479013) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 99-312, full length protein. The amino acid sequence is listed below: LPLRFDWRDK HVVNPVRNQE MCGGCWAFSV VSAIESARAI QGKSLDYLSV QQVIDCSFNN SGCLGGSPLC ALRWLNETQL KLVADSQYPF KAVNGQCRHF PQSQAGVSVK DFSAYNFRGQ EDEMARALLS FGPLVVIVDA MSWQDYLGGI IQHHCSSGEA NHAVLITGFD RTGNTPYWMV RNSWGSSWGV EGYAHVKMGG NVCGIADSVA AVFV. It is sometimes possible for the material contained within the vial of "Cathepsin O (Ctso), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
