Cathepsin L1 (CTSL1) Recombinant Protein | CTSL1 recombinant protein
Recombinant Pig Cathepsin L1 (CTSL1)
Gene Names
CTSV; CTSL; CTSL1; CTSL2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cathepsin L1 (CTSL1); Recombinant Pig Cathepsin L1 (CTSL1); CTSL1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
118-289, Full length protein
Sequence
VDWREKGYVTAVKNQGQCGSCWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNGGLMDNAFQYVKDNGGLDTEESYPYLGRETNSCTYKPECSAANDTGFVDIPQREKALMKAVATVGPISVAIDAGHSSFQFYKSGIYYDPDCSSKDLDHGVLVVGYGFEGT
Sequence Length
172
Species
Sus scrofa (Pig)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for CTSL1 recombinant protein
This protein is a lysosomal cysteine proteinase that plays a major role in intracellular protein catabolism. Its substrates include collagen and elastin, as well as alpha-1 protease inhibitor, a major controlling element of neutrophil elastase activity. The encoded protein has been implicated in several pathologic processes, including myofibril necrosis in myopathies and in myocardial ischemia, and in the renal tubular response to proteinuria. This protein, which is a member of the peptidase C1 family, is a dimer composed of disulfide-linked heavy and light chains, both produced from a single protein precursor. At least two transcript variants encoding the same protein have been found for this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,178 Da
NCBI Official Full Name
cathepsin L1
NCBI Official Symbol
CTSV
NCBI Official Synonym Symbols
CTSL; CTSL1; CTSL2
NCBI Protein Information
cathepsin L1
UniProt Protein Name
Cathepsin L1
UniProt Gene Name
CTSL
UniProt Synonym Gene Names
CTSL1
Uniprot Description
Important for the overall degradation of proteins in lysosomes.
Research Articles on CTSL1
Similar Products
Product Notes
The CTSL1 ctsl (Catalog #AAA1486220) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 118-289, Full length protein. The amino acid sequence is listed below: VDWREKGYVT AVKNQGQCGS CWAFSATGAL EGQMFRKTGK LVSLSEQNLV DCSRPQGNQG CNGGLMDNAF QYVKDNGGLD TEESYPYLGR ETNSCTYKPE CSAANDTGFV DIPQREKALM KAVATVGPIS VAIDAGHSSF QFYKSGIYYD PDCSSKDLDH GVLVVGYGFE GT. It is sometimes possible for the material contained within the vial of "Cathepsin L1 (CTSL1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
