Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Mouse CTLA-4/CD152 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

CTLA-4/CD152 Recombinant Protein | CTLA-4 recombinant protein

Recombinant Mouse CTLA-4/CD152 Protein

Gene Names
Ctla4; Cd152; Ly-56; Ctla-4
Purity
>95% by SDS-PAGE.
Synonyms
CTLA-4/CD152; Recombinant Mouse CTLA-4/CD152 Protein; Cytotoxic T-lymphocyte protein 4; Cytotoxic T-lymphocyte-associated antigen 4; CTLA-4; CD152; Ctla4; CTLA-4 recombinant protein
Ordering
For Research Use Only!
Host
Human Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 um filtered solution of PBS, pH7.4.
Sequence
AIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD
Sequence Length
223
Species
Mouse
Endotoxin
< 1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
Fc tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Mouse CTLA-4/CD152 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

SDS-Page (Recombinant Mouse CTLA-4/CD152 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)
Related Product Information for CTLA-4 recombinant protein
Description: Recombinant Mouse CTLA-4/CD152 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Ala37-Asp161) of mouse CTLA-4/CD152 (Accession #P09793) fused with an Fc tag at the C-terminus.

Background: Mouse Cytotoxic Tlymphocyte 4(CTLA-4,CD152), is a type I transmembrane T cell inhibitory molecule. Withinthe ECD, Mouse CTLA-4 shares 68% aa sequence identity with human. CTLA4 is similar to the T cellcostimulatory protein CD28 since both of the molecules bind to CD80 and CD86 on antigen-presenting cells.CTLA4 transmits an inhibitory signal to T cells, whereas CD28 transmits a stimulatory signal. Intracellular CTLA4is also found inregulatory T cells and may play an important role in their functions. T cell activation through theT cell receptor and CD28 leads to increased expression of CTLA4. Genetic variations of CTLA4 have beenassociated with susceptibility to systemic lupus erythematosus(SLE), Gravesdisease(GRD), Celiac diseasetype3(CELIAC3) and Hepatitis B virus infection(HBVinfection).
Product Categories/Family for CTLA-4 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
Cytotoxic T-lymphocyte protein 4
NCBI Official Synonym Full Names
cytotoxic T-lymphocyte-associated protein 4
NCBI Official Symbol
Ctla4
NCBI Official Synonym Symbols
Cd152; Ly-56; Ctla-4
NCBI Protein Information
cytotoxic T-lymphocyte protein 4
UniProt Protein Name
Cytotoxic T-lymphocyte protein 4
UniProt Gene Name
Ctla4
UniProt Synonym Gene Names
Cd152; CTLA-4
UniProt Entry Name
CTLA4_MOUSE

NCBI Description

This gene is a member of the immunoglobulin superfamily, and encodes a protein that functions as a negative regulator of T-cell responses. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Aug 2013]

Uniprot Description

CTLA-4: Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28. Genetic variation in CTLA4 influences susceptibility to systemic lupus erythematosus (SLE). SLE is a chronic, inflammatory and often febrile multisystemic disorder of connective tissue. It affects principally the skin, joints, kidneys and serosal membranes. SLE is thought to represent a failure of the regulatory mechanisms of the autoimmune system. Genetic variations in CTLA4 may influence susceptibility to Graves disease, an autoimmune disorder associated with overactivity of the thyroid gland and hyperthyroidism. Genetic variation in CTLA4 is the cause of susceptibility to diabetes mellitus insulin-dependent type 12 (IDDM12). A multifactorial disorder of glucose homeostasis that is characterized by susceptibility to ketoacidosis in the absence of insulin therapy. Clinical fetaures are polydipsia, polyphagia and polyuria which result from hyperglycemia-induced osmotic diuresis and secondary thirst. These derangements result in long-term complications that affect the eyes, kidneys, nerves, and blood vessels. Genetic variation in CTLA4 is the cause of susceptibility to celiac disease type 3 (CELIAC3). It is a multifactorial disorder of the small intestine that is influenced by both environmental and genetic factors. It is characterized by malabsorption resulting from inflammatory injury to the mucosa of the small intestine after the ingestion of wheat gluten or related rye and barley proteins. In its classic form, celiac disease is characterized in children by malabsorption and failure to thrive. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Immunoglobulin superfamily; Membrane protein, integral

Cellular Component: Golgi apparatus; membrane; perinuclear region of cytoplasm; plasma membrane; integral to membrane; clathrin-coated endocytic vesicle; external side of plasma membrane

Biological Process: B cell receptor signaling pathway; negative regulation of T cell proliferation; positive regulation of apoptosis; immune system process; negative regulation of regulatory T cell differentiation; negative regulation of immune response; immune response; negative regulation of B cell proliferation; response to DNA damage stimulus

Research Articles on CTLA-4

Similar Products

Product Notes

The CTLA-4 ctla4 (Catalog #AAA9140186) is a Recombinant Protein produced from Human Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: AIQVTQPSVV LASSHGVASF PCEYSPSHNT DEVRVTVLRQ TNDQMTEVCA TTFTEKNTVG FLDYPFCSGT FNESRVNLTI QGLRAVDTGL YLCKVELMYP PPYFVGMGNG TQIYVIDPEP CPDSD. It is sometimes possible for the material contained within the vial of "CTLA-4/CD152, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.