Cardiotrophin-1 (Ctf1) Recombinant Protein | Ctf1 recombinant protein
Recombinant Mouse Cardiotrophin-1 (Ctf1)
Gene Names
Ctf1; CT-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cardiotrophin-1 (Ctf1); Recombinant Mouse Cardiotrophin-1 (Ctf1); Ctf1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-203, full length protein
Sequence
MSQREGSLEDHQTDSSISFLPHLEAKIRQTHNLARLLTKYAEQLLEEYVQQQGEPFGLPGFSPPRLPLAGLSGPAPSHAGLPVSERLRQDAAALSVLPALLDAVRRRQAELNPRAPRLLRSLEDAARQVRALGAAVETVLAALGAAARGPGPEPVTVATLFTANSTAGIFSAKVLGFHVCGLYGEWVSRTEGDLGQLVPGGVA
Sequence Length
203
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Ctf1 recombinant protein
This protein is a secreted cytokine that induces cardiac myocyte hypertrophy in vitro. It has been shown to bind and activate the ILST
gp130 receoptor. Two transcript variants encoding different isoforms have been found for this gene.
gp130 receoptor. Two transcript variants encoding different isoforms have been found for this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21,509 Da
NCBI Official Full Name
cardiotrophin-1 isoform 1
NCBI Official Synonym Full Names
cardiotrophin 1
NCBI Official Symbol
Ctf1
NCBI Official Synonym Symbols
CT-1
NCBI Protein Information
cardiotrophin-1
UniProt Protein Name
Cardiotrophin-1
Protein Family
UniProt Gene Name
Ctf1
UniProt Synonym Gene Names
CT-1
Uniprot Description
Induces cardiac myocyte hypertrophy in vitro. Binds to and activates the ILST/gp130 receptor.
Research Articles on Ctf1
Similar Products
Product Notes
The Ctf1 ctf1 (Catalog #AAA1329716) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-203, full length protein. The amino acid sequence is listed below: MSQREGSLED HQTDSSISFL PHLEAKIRQT HNLARLLTKY AEQLLEEYVQ QQGEPFGLPG FSPPRLPLAG LSGPAPSHAG LPVSERLRQD AAALSVLPAL LDAVRRRQAE LNPRAPRLLR SLEDAARQVR ALGAAVETVL AALGAAARGP GPEPVTVATL FTANSTAGIF SAKVLGFHVC GLYGEWVSRT EGDLGQLVPG GVA. It is sometimes possible for the material contained within the vial of "Cardiotrophin-1 (Ctf1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
