Cystatin-C (Cst3) Recombinant Protein | Cst3 recombinant protein

Recombinant Mouse Cystatin-C (Cst3)

Cat. Num. AAA952541

• Gene Names: Cst3; CysC
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Cystatin-C (Cst3); Recombinant Mouse Cystatin-C (Cst3); Cst3 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 21-140aa; Full Length of Mature Protein
• Sequence: ATPKQGPRMLGAPEEADANEEGVRRALDFAVSEYNKGSNDAYHSRAIQVVRARKQLVAGVNYFLDVEMGRTTCTKSQTNLTDCPFHDQPHLMRKALCSFQIYSVPWKGTHSLTKFSCKNA
• Sequence Length: 140

• Species: Mouse
• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Cst3 recombinant protein

The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes the most abundant extracellular inhibitor of cysteine proteases, which is found in high concentrations in biological fluids and is expressed in virtually all organs of the body. A mutation in this gene has been associated with amyloid angiopathy. Expression of this protein in vascular wall smooth muscle cells is severely reduced in both atherosclerotic and aneurysmal aortic lesions, establishing its role in vascular disease.

NCBI and Uniprot Product Information

• NCBI GI #: 31981822
• NCBI GeneID: 13010
• NCBI Accession #: NP_034106.2
• NCBI GenBank Nucleotide #: NM_009976.4
• UniProt Accession #: P21460; Q544Y0
• Molecular Weight: 20.4 kDa
• NCBI Official Full Name: cystatin-C
• NCBI Official Synonym Full Names: cystatin C
• NCBI Official Symbol: Cst3
• NCBI Official Synonym Symbols: CysC
• NCBI Protein Information: cystatin-C
• UniProt Protein Name: Cystatin-C
• Protein Family: Cystatin
• UniProt Gene Name: Cst3

NCBI Description

The protein encoded by this gene is a cysteine protease inhibitor involved in neurodegenerative and cardiovascular processes. The encoded protein inhibits aggregation of beta-amyloid protein, a hallmark of Alzheimer's disease, so it may be useful as a therapeutic. This protein also may be a biomarker for atherosclerosis. [provided by RefSeq, Aug 2015]

Uniprot Description

As an inhibitor of cysteine proteinases, this protein is thought to serve an important physiological role as a local regulator of this enzyme activity.