Probable mannan synthase 10 (CSLA10) Recombinant Protein | CSLA10 recombinant protein
Recombinant Arabidopsis thaliana Probable mannan synthase 10 (CSLA10)
Gene Names
CSLA10; ATCSLA10; CELLULOSE SYNTHASE LIKE A10; cellulose synthase-like A10; CSLA10; T23E23.23; T23E23_23
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable mannan synthase 10 (CSLA10); Recombinant Arabidopsis thaliana Probable mannan synthase 10 (CSLA10); CSLA10 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-552aa; full length protein
Sequence
MTTFLKSLIFLQDSCLAFLSLMFHRGSSEDAAEALKKLETSINGARISFDTTWTREFRSL FIVPLFKCLVAFCLIISLLVFIEGIYMNLVVLYVKVFERKPEKVYRWEAMQEDIELGHET YPMVLVQIPMYNEKEVLQLSIGAACRLIWPLDRLIVQVLDDSTDQTIKELVNTECAKWES KGVNIKCERRDNRNGYKAGALKEGMKHNYVKLCNYVVIFDADFQPEPDYLQHSVPFLVHN PEVALVQARWRFMNANKCLMTRMQEMSLNYHFMAEQESGSTRHAFFSFNGTAGVWRMAAM EEAGGWHDRTTVEDMDLAVRAGLLGWKFVFLNDLTVKSELPSKFKAFRFQQHRWSCGPAN LFRKMIMEIIRNKRVTIWKKLYLVYSFFFLRKIIVHCFTFIFYCVILPTSVFFPEVNIPA WSTFYIPSMITLCIVIATPRSFYLVIFWILFENVMSMHRTKGTFIGILERQRVNEWVVTE KLGDALKTKLLPRIGKPSNMFLERVNSKEIMVGIYILCCACYGLFFGNTLLYLYLFMQAV AFLISGVGFVGT
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for CSLA10 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
64,155 Da
NCBI Official Full Name
cellulose synthase-like A10
NCBI Official Symbol
CSLA10
NCBI Official Synonym Symbols
ATCSLA10; CELLULOSE SYNTHASE LIKE A10; cellulose synthase-like A10; CSLA10; T23E23.23; T23E23_23
NCBI Protein Information
cellulose synthase-like A10
UniProt Protein Name
Probable mannan synthase 10
Protein Family
UniProt Gene Name
CSLA10
UniProt Synonym Gene Names
AtCslA10
UniProt Entry Name
CSLAA_ARATH
NCBI Description
encodes a gene similar to cellulose synthase
Uniprot Description
Probable mannan synthase which consists of a 4-beta-mannosyltransferase activity on mannan using GDP-mannose. The beta-1,4-mannan product is the backbone for galactomannan synthesis by galactomannan galactosyltransferase. Galactomannan is a noncellulosic polysaccharides of plant cell wall (). Required for synthesis of a cell wall polysaccharide.
Similar Products
Product Notes
The CSLA10 csla10 (Catalog #AAA7013099) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-552aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the CSLA10 csla10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTTFLKSLIF LQDSCLAFLS LMFHRGSSED AAEALKKLET SINGARISFD TTWTREFRSL FIVPLFKCLV AFCLIISLLV FIEGIYMNLV VLYVKVFERK PEKVYRWEAM QEDIELGHET YPMVLVQIPM YNEKEVLQLS IGAACRLIWP LDRLIVQVLD DSTDQTIKEL VNTECAKWES KGVNIKCERR DNRNGYKAGA LKEGMKHNYV KLCNYVVIFD ADFQPEPDYL QHSVPFLVHN PEVALVQARW RFMNANKCLM TRMQEMSLNY HFMAEQESGS TRHAFFSFNG TAGVWRMAAM EEAGGWHDRT TVEDMDLAVR AGLLGWKFVF LNDLTVKSEL PSKFKAFRFQ QHRWSCGPAN LFRKMIMEII RNKRVTIWKK LYLVYSFFFL RKIIVHCFTF IFYCVILPTS VFFPEVNIPA WSTFYIPSMI TLCIVIATPR SFYLVIFWIL FENVMSMHRT KGTFIGILER QRVNEWVVTE KLGDALKTKL LPRIGKPSNM FLERVNSKEI MVGIYILCCA CYGLFFGNTL LYLYLFMQAV AFLISGVGFV GT. It is sometimes possible for the material contained within the vial of "Probable mannan synthase 10 (CSLA10), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
