Granulocyte colony-stimulating factor (CSF3) Recombinant Protein | CSF3 recombinant protein

Recombinant Human Granulocyte colony-stimulating factor (CSF3), partial

Cat. Num. AAA1265329

• Gene Names: CSF3; GCSF; CSF3OS; C17orf33
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Granulocyte colony-stimulating factor (CSF3); Recombinant Human Granulocyte colony-stimulating factor (CSF3); partial; Colony-stimulating factor ; CSFMolgramostin; Sargramostim; CSF3 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 27-200aa, Partial
• Sequence: VQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRV

• Species: Homo sapiens (Human)
• Subcellular Location: Secreted
• Protein Families: IL-6 superfamily
• Pathway: Jak-STAT signaling pathway
• Relevance: Cytokine that stimulates the growth and differentiation of hatopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes.
• Function: Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

Product Categories/Family for CSF3 recombinant protein

Immunology

References

SeattleSNPs variation discovery resourceThe DNA sequence and comparative analysis of human chromosome 5.Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S., Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.Nature 431:268-274(2004)
https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=HGNC:2438
https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Hs&CID=2233
https://www.genome.jp/dbget-bin/www_bget?hsa:1440
https://string-db.org/network/9606.ENSP00000225474
https://www.omim.org/entry/138970138970138970

NCBI and Uniprot Product Information

• NCBI GI #: 296011057
• NCBI GeneID: 1440
• NCBI Accession #: NP_001171618.1
• NCBI GenBank Nucleotide #: NM_001178147.1
• UniProt Accession #: P09919; A8MXR7
• Molecular Weight: 22,293 Da
• NCBI Official Full Name: granulocyte colony-stimulating factor isoform d
• NCBI Official Synonym Full Names: colony stimulating factor 3 (granulocyte)
• NCBI Official Symbol: CSF3
• NCBI Official Synonym Symbols: GCSF; CSF3OS; C17orf33
• NCBI Protein Information: granulocyte colony-stimulating factor; filgrastim; lenograstim; pluripoietin
• UniProt Protein Name: Granulocyte colony-stimulating factor
• Protein Family: Granulocyte colony-stimulating factor
• UniProt Gene Name: CSF3
• UniProt Synonym Gene Names: C17orf33; GCSF; G-CSF
• UniProt Entry Name: CSF3_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of granulocytes. The active protein is found extracellularly. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, May 2010]

Uniprot Description

G-CSF: Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes. Belongs to the IL-6 superfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Cell cycle regulation; Cytokine; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 17q11.2-q12

Cellular Component: extracellular space

Molecular Function: enzyme binding; growth factor activity; cytokine activity; granulocyte colony-stimulating factor receptor binding

Biological Process: granulocyte differentiation; positive regulation of myeloid cell differentiation; positive regulation of protein binding; multicellular organismal development; cytokine and chemokine mediated signaling pathway; positive regulation of peptidyl-serine phosphorylation; positive regulation of phosphoinositide 3-kinase cascade; positive regulation of protein kinase B signaling cascade; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of actin filament polymerization; positive regulation of cell proliferation; positive regulation of transcription factor import into nucleus; immune response; positive regulation of transcription from RNA polymerase II promoter