Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-CDK19 Polyclonal Antibody)

Rabbit anti-Human CDK19 Polyclonal Antibody | anti-CDK19 antibody

CDK19 Polyclonal Antibody

Gene Names
CDK19; CDK11; CDC2L6; bA346C16.3
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
CDK19; Polyclonal Antibody; CDK19 Polyclonal Antibody; CDC2L6; CDK11; bA346C16.3; cyclin-dependent kinase 19; anti-CDK19 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
0.77 mg/ml (varies by lot)
Sequence Length
502
Applicable Applications for anti-CDK19 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CDK19 (XP_005266928.1).
Immunogen Sequence
QQQNQHQQPTAPPQQAAAPPQAPPPQQNSTQTNGTAGGAGAGVGGTGAGLQHSQDSSLNQVPPNKKPRLGPSGANSGGPVMPSDYQHSSSRLNYQSSVQGS
Positive Samples
DU145, U-87MG, A-549, HeLa
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-CDK19 Polyclonal Antibody)

Western Blot (WB) (Western blot-CDK19 Polyclonal Antibody)
Related Product Information for anti-CDK19 antibody
This gene encodes a protein that is one of the components of the Mediator co-activator complex. The Mediator complex is a multi-protein complex required for transcriptional activation by DNA binding transcription factors of genes transcribed by RNA polymerase II. The protein encoded by this gene is similar to cyclin-dependent kinase 8 which can also be a component of the Mediator complex. Alternative splicing results in multiple transcript variants encoding distinct isoforms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 49kDa; 56kDa
Observed: 57kDa
NCBI Official Full Name
cyclin-dependent kinase 19 isoform 1
NCBI Official Synonym Full Names
cyclin dependent kinase 19
NCBI Official Symbol
CDK19
NCBI Official Synonym Symbols
CDK11; CDC2L6; bA346C16.3
NCBI Protein Information
cyclin-dependent kinase 19
UniProt Protein Name
Cyclin-dependent kinase 19
Protein Family
UniProt Gene Name
CDK19
UniProt Synonym Gene Names
CDC2L6; CDK11; KIAA1028
UniProt Entry Name
CDK19_HUMAN

NCBI Description

This gene encodes a protein that is one of the components of the Mediator co-activator complex. The Mediator complex is a multi-protein complex required for transcriptional activation by DNA binding transcription factors of genes transcribed by RNA polymerase II. The protein encoded by this gene is similar to cyclin-dependent kinase 8 which can also be a component of the Mediator complex. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2014]

Uniprot Description

Catalytic activity: ATP + a protein = ADP + a phosphoprotein.

Sequence similarities: Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.Contains 1 protein kinase domain.

Sequence caution: The sequence AAH24247.1 differs from that shown. Reason: Erroneous initiation.

Research Articles on CDK19

Similar Products

Product Notes

The CDK19 cdk19 (Catalog #AAA9140720) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDK19 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDK19 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the CDK19 cdk19 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CDK19, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.