Beta-crystallin S (CRYGS) Recombinant Protein | CRYGS recombinant protein
Recombinant Dog Beta-crystallin S (CRYGS)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Beta-crystallin S (CRYGS); Recombinant Dog Beta-crystallin S (CRYGS); CRYGS recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-178, Full length protein
Sequence
SKSGTKITFYEDKHFQGRHYDCDCDCADFHMYLSRCNSIRVEGGTWAVYERPNFAGYMYILPRGEYPEYQHWMGLNDRLSSCRAVHLSSGGQYKIQIFEKGDFNGQMYETTEDCPSIMEQFHMREVHSSKVLDGVWIFYELPNYRGRQYLLDKKEYRKPIDWGAASPAVQSFRRIVE
Sequence Length
177
Species
Canis familiaris (Dog) (Canis lupus familiaris)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for CRYGS recombinant protein
Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and gamma crystallins are also considered as a superfamily. Alpha and beta families are further divided into acidic and basic groups. Seven protein regions exist in crystallins: four homologous motifs, a connecting peptide, and N- and C-terminal extensions. Gamma-crystallins are a homogeneous group of highly symmetrical, monomeric proteins typically lacking connecting peptides and terminal extensions. They are differentially regulated after early development. This gene encodes a protein initially considered to be a beta-crystallin but the encoded protein is monomeric and has greater sequence similarity to other gamma-crystallins. This gene encodes the most significant gamma-crystallin in adult eye lens tissue. Whether due to aging or mutations in specific genes, gamma-crystallins have been involved in cataract formation.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21,037 Da
NCBI Official Full Name
beta-crystallin S
NCBI Official Synonym Full Names
crystallin gamma S
NCBI Official Symbol
CRYGS
NCBI Protein Information
beta-crystallin S
UniProt Protein Name
Beta-crystallin S
Protein Family
UniProt Gene Name
CRYGS
Uniprot Description
Crystallins are the dominant structural components of the vertebrate eye lens.
Research Articles on CRYGS
Similar Products
Product Notes
The CRYGS crygs (Catalog #AAA948289) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-178, Full length protein. The amino acid sequence is listed below: SKSGTKITFY EDKHFQGRHY DCDCDCADFH MYLSRCNSIR VEGGTWAVYE RPNFAGYMYI LPRGEYPEYQ HWMGLNDRLS SCRAVHLSSG GQYKIQIFEK GDFNGQMYET TEDCPSIMEQ FHMREVHSSK VLDGVWIFYE LPNYRGRQYL LDKKEYRKPI DWGAASPAVQ SFRRIVE. It is sometimes possible for the material contained within the vial of "Beta-crystallin S (CRYGS), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
