Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Complement receptor type 2 Recombinant Protein | Cr2 recombinant protein

Recombinant Mouse Complement receptor type 2

Gene Names
Cr2; Cr1; C3DR; CD21; CD35; Cr-1; Cr-2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Complement receptor type 2; Recombinant Mouse Complement receptor type 2; Complement C3d receptor; CD_antigen: CD21; Cr2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
729-963aa; Partial
Sequence
LYGNEVSYECDEGFYLLGEKSLQCVNDSKGHGSWSGPPPQCLQSSPLTHCPDPEVKHGYKLNKTHSAFSHNDIVHFVCNQGFIMNGSHLIRCHTNNTWLPGVPTCIRKASLGCQSPSTIPNGNHTGGSIARFPPGMSVMYSCYQGFLMAGEARLICTHEGTWSQPPPFCKEVNCSFPEDTNGIQKGFQPGKTYRFGATVTLECEDGYTLEGSPQSQCQDDSQWNPPLALCKYRRW
Sequence Length
1025
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for Cr2 recombinant protein
Receptor for complement C3d. Participates in B lymphocytes activation.
Product Categories/Family for Cr2 recombinant protein
References
"Comparative structure and evolution of murine CR2. The homolog of the human C3d/EBV receptor (CD21)." Fingeroth J.D. J. Immunol. 144:3458-3467(1990)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
28 kDa
NCBI Official Full Name
Complement receptor type 2
NCBI Official Synonym Full Names
complement receptor 2
NCBI Official Symbol
Cr2
NCBI Official Synonym Symbols
Cr1; C3DR; CD21; CD35; Cr-1; Cr-2
NCBI Protein Information
complement receptor type 2
UniProt Protein Name
Complement receptor type 2
Protein Family
UniProt Gene Name
Cr2
UniProt Synonym Gene Names
Cr2
UniProt Entry Name
CR2_MOUSE

Uniprot Description

CR2: Receptor for complement C3Dd, for the Epstein-Barr virus on human B-cells and T-cells and for HNRPU. Participates in B lymphocytes activation. Genetic variations in CR2 are associated with susceptibility to systemic lupus erythematosus type 9 (SLEB9). Systemic lupus erythematosus (SLE) is a chronic autoimmune disease with a complex genetic basis. SLE is an inflammatory, and often febrile multisystemic disorder of connective tissue characterized principally by involvement of the skin, joints, kidneys, and serosal membranes. It is thought to represent a failure of the regulatory mechanisms of the autoimmune system. Defects in CR2 are the cause of immunodeficiency, common variable, type 7 (CVID7). A primary immunodeficiency characterized by antibody deficiency, hypogammaglobulinemia, recurrent bacterial infections and an inability to mount an antibody response to antigen. The defect results from a failure of B-cell differentiation and impaired secretion of immunoglobulins; the numbers of circulating B cells is usually in the normal range, but can be low. Belongs to the receptors of complement activation (RCA) family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Receptor, misc.

Cellular Component: external side of plasma membrane; integral to membrane; membrane; receptor complex

Molecular Function: complement binding; complement receptor activity; DNA binding; protein binding; protein homodimerization activity; receptor activity

Biological Process: B cell activation; B cell differentiation; B cell proliferation; complement activation, classical pathway; immune system process; innate immune response

Research Articles on Cr2

Similar Products

Product Notes

The Cr2 cr2 (Catalog #AAA964515) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 729-963aa; Partial. The amino acid sequence is listed below: LYGNEVSYEC DEGFYLLGEK SLQCVNDSKG HGSWSGPPPQ CLQSSPLTHC PDPEVKHGYK LNKTHSAFSH NDIVHFVCNQ GFIMNGSHLI RCHTNNTWLP GVPTCIRKAS LGCQSPSTIP NGNHTGGSIA RFPPGMSVMY SCYQGFLMAG EARLICTHEG TWSQPPPFCK EVNCSFPEDT NGIQKGFQPG KTYRFGATVT LECEDGYTLE GSPQSQCQDD SQWNPPLALC KYRRW. It is sometimes possible for the material contained within the vial of "Complement receptor type 2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.