NADPH--cytochrome P450 reductase (cprA) Recombinant Protein | cprA recombinant protein
Recombinant Aspergillus niger NADPH--cytochrome P450 reductase (cprA), partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
NADPH--cytochrome P450 reductase (cprA); Recombinant Aspergillus niger NADPH--cytochrome P450 reductase (cprA); partial; cprA recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
273-541. partial, including FAD-binding FR-type Domain
Sequence
PYSAHNPFIAPIAESRELFTVKDRNCLHMEISIAGSNLSYQTGDHIAVWPTNAGAEVDRFLQVFGLEGKRDSVINIKGIDVTAKVPIPTPTTYDAAVRYYMEVCAPVSRQFVATLAAFAPDEESKAEIVRLGSDKDYFHEKVTNQCFNIAQALQSITSKPFSAVPFSLLIEGITKLQPRYYSISSSSLVQKDKISITAVVESVRLPGASHMVKGVTTNYLLALKQKQNGDPSPDPHGLTYSITGPRNKYDGIHVPVHVRHSNFKLPSDP
Sequence Length
541
Species
Aspergillus niger (strain CBS 513.88 / FGSC A1513)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
76,589 Da
NCBI Official Full Name
NADPH--cytochrome P450 reductase
NCBI Official Symbol
ANI_1_1104074
NCBI Protein Information
NADPH--cytochrome P450 reductase
UniProt Protein Name
NADPH--cytochrome P450 reductase
Protein Family
UniProt Gene Name
cprA
UniProt Synonym Gene Names
CPR; P450R
Uniprot Description
This enzyme is required for electron transfer from NADP to cytochrome P450 in microsomes. It can also provide electron transfer to heme oxygenase and cytochrome B5. Involved in ergosterol biosynthesis.
Similar Products
Product Notes
The cprA cpra (Catalog #AAA7056683) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 273-541. partial, including FAD-binding FR-type Domain. The amino acid sequence is listed below: PYSAHNPFIA PIAESRELFT VKDRNCLHME ISIAGSNLSY QTGDHIAVWP TNAGAEVDRF LQVFGLEGKR DSVINIKGID VTAKVPIPTP TTYDAAVRYY MEVCAPVSRQ FVATLAAFAP DEESKAEIVR LGSDKDYFHE KVTNQCFNIA QALQSITSKP FSAVPFSLLI EGITKLQPRY YSISSSSLVQ KDKISITAVV ESVRLPGASH MVKGVTTNYL LALKQKQNGD PSPDPHGLTY SITGPRNKYD GIHVPVHVRH SNFKLPSDP. It is sometimes possible for the material contained within the vial of "NADPH--cytochrome P450 reductase (cprA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
