Cytoplasmic polyadenylation element-binding protein 2 (Cpeb2) Recombinant Protein | Cpeb2 recombinant protein
Recombinant Mouse Cytoplasmic polyadenylation element-binding protein 2 (Cpeb2)
Gene Names
Cpeb2; Cpe-bp2; A630055H10Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cytoplasmic polyadenylation element-binding protein 2 (Cpeb2); Recombinant Mouse Cytoplasmic polyadenylation element-binding protein 2 (Cpeb2); Cpeb2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-521, Full length protein
Sequence
MNLPQQQPPAAAPQQPQSRRSPVSPQLQQQHQAAAAAFLQQRNSYNHHQPLLKQSPWSNHQNSGWGTASMSWGAMHGRDHRRSGNMGIPGTMNQISPLKKPFSGNVIAPPKFTRSTPSLTPKSWIEDNVFRTDNNSNTLLPLQVRSSLQLPAWGSDSLQDSWCTAAGTSRIDQDRSRMYDSLNMHSLENSLIDIMRAEHDPLKGRLSYPHPGTDNLLMLNGRSSLFPIDDSLLDDGHSDQVGVLNSPTCYSAHQNGERIERFSRKVFVGGLPPDIDEDEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVLDDQMCDECQGARCGGKFAPFFCANVTCLQYYCEFCWANIHSRAGREFHKPLVKEGADRPRQIHFRWN
Sequence Length
521
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Cpeb2 recombinant protein
This protein is highly similar to cytoplasmic polyadenylation element binding protein (CPEB), an mRNA-binding protein that regulates cytoplasmic polyadenylation of mRNA as a trans factor in oogenesis and spermatogenesis. Studies of the similar gene in mice suggested a possible role of this protein in transcriptionally inactive haploid spermatids. Alternatively spliced transcript variants encoding distinct isoforms have been described.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
58,442 Da
NCBI Official Full Name
Cytoplasmic polyadenylation element-binding protein 2
NCBI Official Synonym Full Names
cytoplasmic polyadenylation element binding protein 2
NCBI Official Symbol
Cpeb2
NCBI Official Synonym Symbols
Cpe-bp2; A630055H10Rik
NCBI Protein Information
cytoplasmic polyadenylation element-binding protein 2
UniProt Protein Name
Cytoplasmic polyadenylation element-binding protein 2
UniProt Gene Name
Cpeb2
UniProt Synonym Gene Names
CPE-BP2; CPE-binding protein 2; mCPEB-2
Uniprot Description
May play a role in translational regulation of stored mRNAs in transcriptionally inactive haploid spermatids. Binds to poly(U) RNA oligomers (PubMed:12672660). Required for cell cycle progression, specifically for the transition from metaphase to anaphase ().
Research Articles on Cpeb2
Similar Products
Product Notes
The Cpeb2 cpeb2 (Catalog #AAA1326894) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-521, Full length protein. The amino acid sequence is listed below: MNLPQQQPPA AAPQQPQSRR SPVSPQLQQQ HQAAAAAFLQ QRNSYNHHQP LLKQSPWSNH QNSGWGTASM SWGAMHGRDH RRSGNMGIPG TMNQISPLKK PFSGNVIAPP KFTRSTPSLT PKSWIEDNVF RTDNNSNTLL PLQVRSSLQL PAWGSDSLQD SWCTAAGTSR IDQDRSRMYD SLNMHSLENS LIDIMRAEHD PLKGRLSYPH PGTDNLLMLN GRSSLFPIDD SLLDDGHSDQ VGVLNSPTCY SAHQNGERIE RFSRKVFVGG LPPDIDEDEI TASFRRFGPL VVDWPHKAES KSYFPPKGYA FLLFQEESSV QALIDACIEE DGKLYLCVSS PTIKDKPVQI RPWNLSDSDF VMDGSQPLDP RKTIFVGGVP RPLRAVELAM IMDRLYGGVC YAGIDTDPEL KYPKGAGRVA FSNQQSYIAA ISARFVQLQH GDIDKRVEVK PYVLDDQMCD ECQGARCGGK FAPFFCANVT CLQYYCEFCW ANIHSRAGRE FHKPLVKEGA DRPRQIHFRW N. It is sometimes possible for the material contained within the vial of "Cytoplasmic polyadenylation element-binding protein 2 (Cpeb2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
