Cytochrome c oxidase subunit 4 isoform 2, mitochondrial (Cox4i2) Recombinant Protein | Cox4i2 recombinant protein
Recombinant Mouse Cytochrome c oxidase subunit 4 isoform 2, mitochondrial (Cox4i2) , partial
Gene Names
Cox4i2; Cox4b; CoxIV-2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cytochrome c oxidase subunit 4 isoform 2; mitochondrial (Cox4i2); Recombinant Mouse Cytochrome c oxidase subunit 4 isoform 2; partial; Cox4i2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-105, intracellular domain
Sequence
MFSRAARSLVMRTGLRTRGTGTHSPGDAAGSQRRMTPYVDCYAQRSYPMPDEPFCTELSEEQRALKEKEKGSWTQLSQAEKVALYRLQFHETFAEMNHRSNEWKT
Sequence Length
105
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Cox4i2 recombinant protein
Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes isoform 2 of subunit IV. Isoform 1 of subunit IV is encoded by a different gene, however, the two genes show a similar structural organization. Subunit IV is the largest nuclear encoded subunit which plays a pivotal role in COX regulation.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20,206 Da
NCBI Official Full Name
cytochrome c oxidase subunit 4 isoform 2, mitochondrial isoform 2
NCBI Official Synonym Full Names
cytochrome c oxidase subunit 4I2
NCBI Official Symbol
Cox4i2
NCBI Official Synonym Symbols
Cox4b; CoxIV-2
NCBI Protein Information
cytochrome c oxidase subunit 4 isoform 2, mitochondrial
UniProt Protein Name
Cytochrome c oxidase subunit 4 isoform 2, mitochondrial
UniProt Gene Name
Cox4i2
UniProt Synonym Gene Names
Cox4b; COX IV-2
Uniprot Description
This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
Research Articles on Cox4i2
Similar Products
Product Notes
The Cox4i2 cox4i2 (Catalog #AAA1297501) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-105, intracellular domain. The amino acid sequence is listed below: MFSRAARSLV MRTGLRTRGT GTHSPGDAAG SQRRMTPYVD CYAQRSYPMP DEPFCTELSE EQRALKEKEK GSWTQLSQAE KVALYRLQFH ETFAEMNHRS NEWKT . It is sometimes possible for the material contained within the vial of "Cytochrome c oxidase subunit 4 isoform 2, mitochondrial (Cox4i2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
