Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Cytochrome c oxidase subunit 4 isoform 1 Recombinant Protein | COX4I1 recombinant protein

Recombinant Human Cytochrome c oxidase subunit 4 isoform 1, mitochondrial

Gene Names
COX4I1; COX4; COXIV; COX4-1; COXIV-1; COX IV-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cytochrome c oxidase subunit 4 isoform 1; Recombinant Human Cytochrome c oxidase subunit 4 isoform 1; mitochondrial; Cytochrome c oxidase polypeptide IV; Cytochrome c oxidase subunit IV isoform 1; COX IV-1; COX4I1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-169aa; Full Length of Mature Protein
Sequence
AHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK
Sequence Length
169
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for COX4I1 recombinant protein
This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
Product Categories/Family for COX4I1 recombinant protein
References
Isolation of a cDNA clone encoding subunit IV of human cytochrome c oxidase.Zeviani M., Nakagawa M., Herbert J., Lomax M.I., Grossman L.I., Sherbany A.A., Miranda A.F., Dimauro S., Schon E.A.Gene 55:205-217(1987)

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
33.2 kDa
NCBI Official Synonym Full Names
cytochrome c oxidase subunit 4I1
NCBI Official Symbol
COX4I1
NCBI Official Synonym Symbols
COX4; COXIV; COX4-1; COXIV-1; COX IV-1
NCBI Protein Information
cytochrome c oxidase subunit 4 isoform 1, mitochondrial
UniProt Protein Name
Cytochrome c oxidase subunit 4 isoform 1, mitochondrial
Protein Family
UniProt Gene Name
COX4I1
UniProt Synonym Gene Names
COX4; COX IV-1
UniProt Entry Name
COX41_HUMAN

NCBI Description

Cytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit IV isoform 1 of the human mitochondrial respiratory chain enzyme. It is located at the 3' of the NOC4 (neighbor of COX4) gene in a head-to-head orientation, and shares a promoter with it. Pseudogenes related to this gene are located on chromosomes 13 and 14. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2016]

Uniprot Description

COX4I1: This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. Ubiquitous. Belongs to the cytochrome c oxidase IV family.

Protein type: Mitochondrial; Membrane protein, integral; Energy Metabolism - oxidative phosphorylation; EC 1.9.3.1; Oxidoreductase

Chromosomal Location of Human Ortholog: 16q24.1

Cellular Component: membrane; mitochondrial inner membrane; mitochondrial respiratory chain complex IV; mitochondrion; nucleus

Molecular Function: cytochrome-c oxidase activity; protein binding

Biological Process: aerobic respiration; cellular metabolic process; gene expression; generation of precursor metabolites and energy; mitochondrial electron transport, cytochrome c to oxygen; response to nutrient; transcription initiation from RNA polymerase II promoter

Research Articles on COX4I1

Similar Products

Product Notes

The COX4I1 cox4i1 (Catalog #AAA956245) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-169aa; Full Length of Mature Protein. The amino acid sequence is listed below: AHESVVKSED FSLPAYMDRR DHPLPEVAHV KHLSASQKAL KEKEKASWSS LSMDEKVELY RIKFKESFAE MNRGSNEWKT VVGGAMFFIG FTALVIMWQK HYVYGPLPQS FDKEWVAKQT KRMLDMKVNP IQGLASKWDY EKNEWKK. It is sometimes possible for the material contained within the vial of "Cytochrome c oxidase subunit 4 isoform 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.