Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

4-hydroxybenzoate polyprenyltransferase (Coq2) Recombinant Protein | Coq2 recombinant protein

Recombinant Mouse 4-hydroxybenzoate polyprenyltransferase, mitochondrial (Coq2)

Gene Names
Coq2; PHB:PPT; 2310002F18Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
4-hydroxybenzoate polyprenyltransferase (Coq2); Recombinant Mouse 4-hydroxybenzoate polyprenyltransferase; mitochondrial (Coq2); Coq2 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
35-374aa; full length protein
Sequence
AGVPGARDRRAPAPGTQRGRALSLSAAAVVNSAPRPLQPYLRLMRLDKPIGTWLLYLPCT WSIGLAADPGCFPDWYMLSLFGTGAILMRGAGCTINDMWDRDFDKKVTRTANRPIAAGDI STFQSFVFLGGQLTLALGVLLCLNYYSIAMGAASLLLVVTYPLVKRITFWPQLALGLTFN WGALLGWSAVKGSCDPAVCLPLYFSGVMWTLIYDTIYAHQDKKDDALIGLKSTALLFQEN TRQWLSGFGVAMVAALSLAGANNGQTVPYYAAVAAVGAHLAHQIYTVDIHRAEDCWDKFT SNRTVGMLLFLGIVLGNLCKEKTEEAKDAEAVRVGSEQTS
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Coq2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,504 Da
NCBI Official Full Name
4-hydroxybenzoate polyprenyltransferase, mitochondrial
NCBI Official Synonym Full Names
coenzyme Q2 4-hydroxybenzoate polyprenyltransferase
NCBI Official Symbol
Coq2
NCBI Official Synonym Symbols
PHB:PPT; 2310002F18Rik
NCBI Protein Information
4-hydroxybenzoate polyprenyltransferase, mitochondrial
UniProt Protein Name
4-hydroxybenzoate polyprenyltransferase, mitochondrial
UniProt Gene Name
Coq2
UniProt Synonym Gene Names
4-HB polyprenyltransferase; PHB:PPT; PHB:polyprenyltransferase
UniProt Entry Name
COQ2_MOUSE

Uniprot Description

COQ2: Catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. Mediates the second step in the final reaction sequence of coenzyme Q (CoQ) biosynthesis, which is the condensation of the polyisoprenoid side chain with PHB. Defects in COQ2 are the cause of coenzyme Q10 deficiency, primary, type 1 (COQ10D1). An autosomal recessive disorder with variable manifestations consistent with 5 major phenotypes. The phenotypes include an encephalomyopathic form with seizures and ataxia; a multisystem infantile form with encephalopathy, cardiomyopathy and renal failure; a predominantly cerebellar form with ataxia and cerebellar atrophy; Leigh syndrome with growth retardation; and an isolated myopathic form. Belongs to the UbiA prenyltransferase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Mitochondrial; Transferase; EC 2.5.1.39; Membrane protein, integral; Cofactor and Vitamin Metabolism - ubiquinone and other terpenoid-quinone biosynthesis

Cellular Component: integral to membrane; membrane; mitochondrial inner membrane; mitochondrion

Molecular Function: 4-hydroxybenzoate decaprenyltransferase activity; 4-hydroxybenzoate nonaprenyltransferase activity; prenyltransferase activity; transferase activity

Biological Process: glycerol metabolic process; isoprenoid biosynthetic process; ubiquinone biosynthetic process

Research Articles on Coq2

Similar Products

Product Notes

The Coq2 coq2 (Catalog #AAA7012334) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 35-374aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Coq2 coq2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AGVPGARDRR APAPGTQRGR ALSLSAAAVV NSAPRPLQPY LRLMRLDKPI GTWLLYLPCT WSIGLAADPG CFPDWYMLSL FGTGAILMRG AGCTINDMWD RDFDKKVTRT ANRPIAAGDI STFQSFVFLG GQLTLALGVL LCLNYYSIAM GAASLLLVVT YPLVKRITFW PQLALGLTFN WGALLGWSAV KGSCDPAVCL PLYFSGVMWT LIYDTIYAHQ DKKDDALIGL KSTALLFQEN TRQWLSGFGV AMVAALSLAG ANNGQTVPYY AAVAAVGAHL AHQIYTVDIH RAEDCWDKFT SNRTVGMLLF LGIVLGNLCK EKTEEAKDAE AVRVGSEQTS. It is sometimes possible for the material contained within the vial of "4-hydroxybenzoate polyprenyltransferase (Coq2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.