COP9 signalosome complex subunit 5 (Cops5) Recombinant Protein | Cops5 recombinant protein

Recombinant Mouse COP9 signalosome complex subunit 5 (Cops5)

Cat. Num. AAA1016431

• Gene Names: Cops5; CSN5; Jab1; Sgn5; Mov34; AI303502
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: COP9 signalosome complex subunit 5 (Cops5); Recombinant Mouse COP9 signalosome complex subunit 5 (Cops5); Cops5 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-334, Full length protein
• Sequence: AASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQINVA
• Sequence Length: 333

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Cops5 recombinant protein

This protein is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. This protein is reported to be involved in the degradation of cyclin-dependent kinase inhibitor CDKN1B
p27Kip1. It is also known to be an coactivator that increases the specificity of JUN
AP1 transcription factors.

NCBI and Uniprot Product Information

• NCBI GI #: 459447369
• NCBI GeneID: 26754
• NCBI Accession #: NP_001264030.1
• NCBI GenBank Nucleotide #: NM_001277101.1
• UniProt Accession #: O35864; Q3UA70; Q8C1S1
• Molecular Weight: 37,549 Da
• NCBI Official Full Name: COP9 signalosome complex subunit 5 isoform 2
• NCBI Official Synonym Full Names: COP9 signalosome subunit 5
• NCBI Official Symbol: Cops5
• NCBI Official Synonym Symbols: CSN5; Jab1; Sgn5; Mov34; AI303502
• NCBI Protein Information: COP9 signalosome complex subunit 5
• UniProt Protein Name: COP9 signalosome complex subunit 5
• UniProt Gene Name: Cops5
• UniProt Synonym Gene Names: Csn5; Jab1; Kic2; SGN5; Signalosome subunit 5

Uniprot Description

Probable protease subunit of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of the SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. Promotes the proteasomal degradation of BRSK2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. In the complex, it probably acts as the catalytic center that mediates the cleavage of Nedd8 from cullins. It however has no metalloprotease activity by itself and requires the other subunits of the CSN complex. Interacts directly with a large number of proteins that are regulated by the CSN complex, confirming a key role in the complex.