Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Catechol O-methyltransferase Recombinant Protein | Comt recombinant protein

Catechol O-methyltransferase

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Catechol O-methyltransferase; Comt recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-264. Provide the full length of Isoform 1, namely the full length of Membrane-bound form (Membrane-bound, MB-COMT)
Sequence
MPLAAVSLGLLLLALLLLLRHLGWGLVTIFWFEYVLQPVHNLIMGDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSPDKS
Sequence Length
264
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Comt recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for Comt recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,747 Da
NCBI Official Full Name
catechol O-methyltransferase
NCBI Official Synonym Full Names
catechol-O-methyltransferase
NCBI Official Symbol
Comt
NCBI Protein Information
catechol O-methyltransferase
UniProt Protein Name
Catechol O-methyltransferase
UniProt Gene Name
Comt
UniProt Entry Name
COMT_RAT

NCBI Description

catalyzes the conversion of S-adenosyl-L-methionine and catechol to S-adenosyl-L-homocysteine and guaiacol [RGD, Feb 2006]

Uniprot Description

COMT: Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Also shortens the biological half-lives of certain neuroactive drugs, like L-DOPA, alpha-methyl DOPA and isoproterenol. Belongs to the mammalian catechol-O-methyltransferase family. 2 isoforms of the human protein are produced by alternative initiation.

Protein type: Membrane protein, integral; EC 2.1.1.6; Amino Acid Metabolism - tyrosine; Methyltransferase

Cellular Component: axon; cytosol; dendrite; dendritic spine; membrane; mitochondrion; plasma membrane; postsynaptic membrane

Molecular Function: catechol O-methyltransferase activity

Biological Process: catechol metabolic process; cellular response to phosphate starvation; developmental process; dopamine catabolic process; dopamine metabolic process; estrogen metabolic process; female pregnancy; learning; negative regulation of dopamine metabolic process; negative regulation of smooth muscle cell proliferation; positive regulation of homocysteine metabolic process; regulation of sensory perception of pain; reproductive process in a multicellular organism; response to drug; response to lipopolysaccharide; response to organic cyclic substance; response to pain; S-adenosylhomocysteine metabolic process; S-adenosylmethionine metabolic process; short-term memory

Research Articles on Comt

Similar Products

Product Notes

The Comt comt (Catalog #AAA7042576) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-264. Provide the full length of Isoform 1, namely the full length of Membrane-bound form (Membrane-bound, MB-COMT). The amino acid sequence is listed below: MPLAAVSLGL LLLALLLLLR HLGWGLVTIF WFEYVLQPVH NLIMGDTKEQ RILRYVQQNA KPGDPQSVLE AIDTYCTQKE WAMNVGDAKG QIMDAVIREY SPSLVLELGA YCGYSAVRMA RLLQPGARLL TMEMNPDYAA ITQQMLNFAG LQDKVTILNG ASQDLIPQLK KKYDVDTLDM VFLDHWKDRY LPDTLLLEKC GLLRKGTVLL ADNVIVPGTP DFLAYVRGSS SFECTHYSSY LEYMKVVDGL EKAIYQGPSS PDKS . It is sometimes possible for the material contained within the vial of "Catechol O-methyltransferase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.