Catechol O-methyltransferase Recombinant Protein | Comt recombinant protein

Catechol O-methyltransferase

Cat. Num. AAA7042576

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Catechol O-methyltransferase; Comt recombinant protein

• Host: Cell Free Expression
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 1-264. Provide the full length of Isoform 1, namely the full length of Membrane-bound form (Membrane-bound, MB-COMT)
• Sequence: MPLAAVSLGLLLLALLLLLRHLGWGLVTIFWFEYVLQPVHNLIMGDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSPDKS
• Sequence Length: 264

• Species: Rattus norvegicus (Rat)
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for Comt recombinant protein

This is a recombinant transmembrane protein expressed in a cell-free expression system.

Product Categories/Family for Comt recombinant protein

Transmembrane Protein

NCBI and Uniprot Product Information

• NCBI GI #: 6978681
• NCBI GeneID: 24267
• NCBI Accession #: NP_036663.1
• NCBI GenBank Nucleotide #: NM_012531.2
• UniProt Accession #: P22734
• Molecular Weight: 24,747 Da
• NCBI Official Full Name: catechol O-methyltransferase
• NCBI Official Synonym Full Names: catechol-O-methyltransferase
• NCBI Official Symbol: Comt
• NCBI Protein Information: catechol O-methyltransferase
• UniProt Protein Name: Catechol O-methyltransferase
• Protein Family: Catechol O-methyltransferase
• UniProt Gene Name: Comt
• UniProt Entry Name: COMT_RAT

NCBI Description

catalyzes the conversion of S-adenosyl-L-methionine and catechol to S-adenosyl-L-homocysteine and guaiacol [RGD, Feb 2006]

Uniprot Description

COMT: Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Also shortens the biological half-lives of certain neuroactive drugs, like L-DOPA, alpha-methyl DOPA and isoproterenol. Belongs to the mammalian catechol-O-methyltransferase family. 2 isoforms of the human protein are produced by alternative initiation.

Protein type: Membrane protein, integral; EC 2.1.1.6; Amino Acid Metabolism - tyrosine; Methyltransferase

Cellular Component: axon; cytosol; dendrite; dendritic spine; membrane; mitochondrion; plasma membrane; postsynaptic membrane

Molecular Function: catechol O-methyltransferase activity

Biological Process: catechol metabolic process; cellular response to phosphate starvation; developmental process; dopamine catabolic process; dopamine metabolic process; estrogen metabolic process; female pregnancy; learning; negative regulation of dopamine metabolic process; negative regulation of smooth muscle cell proliferation; positive regulation of homocysteine metabolic process; regulation of sensory perception of pain; reproductive process in a multicellular organism; response to drug; response to lipopolysaccharide; response to organic cyclic substance; response to pain; S-adenosylhomocysteine metabolic process; S-adenosylmethionine metabolic process; short-term memory