Cytochrome c oxidase assembly factor 5 (COA5) Recombinant Protein | COA5 recombinant protein
Recombinant Human Cytochrome c oxidase assembly factor 5 (COA5)
Gene Names
COA5; Pet191; C2orf64; CEMCOX3; 6330578E17Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cytochrome c oxidase assembly factor 5 (COA5); Recombinant Human Cytochrome c oxidase assembly factor 5 (COA5); COA5 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-74, Full length protein
Sequence
MPKYYEDKPQGGACAGLKEDLGACLLQSDCVVQEGKSPRQCLKEGYCNSLKYAFFECKRSVLDNRARFRGRKGY
Sequence Length
74
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
8,376 Da
NCBI Official Full Name
cytochrome c oxidase assembly factor 5
NCBI Official Synonym Full Names
cytochrome c oxidase assembly factor 5
NCBI Official Symbol
COA5
NCBI Official Synonym Symbols
Pet191; C2orf64; CEMCOX3; 6330578E17Rik
NCBI Protein Information
cytochrome c oxidase assembly factor 5
UniProt Protein Name
Cytochrome c oxidase assembly factor 5
Protein Family
UniProt Gene Name
COA5
UniProt Synonym Gene Names
C2orf64
NCBI Description
This gene encodes an ortholog of yeast Pet191, which in yeast is a subunit of a large oligomeric complex associated with the mitochondrial inner membrane, and required for the assembly of the cytochrome c oxidase complex. Mutations in this gene are associated with mitochondrial complex IV deficiency, a disorder of the mitochondrial respiratory chain with heterogeneous clinical manifestations, ranging from isolated myopathy to a severe disease affecting several tissues and organs. [provided by RefSeq, Dec 2011]
Uniprot Description
Involved in an early step of the mitochondrial complex IV assembly process.
Research Articles on COA5
Similar Products
Product Notes
The COA5 coa5 (Catalog #AAA1474561) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-74, Full length protein. The amino acid sequence is listed below: MPKYYEDKPQ GGACAGLKED LGACLLQSDC VVQEGKSPRQ CLKEGYCNSL KYAFFECKRS VLDNRARFRG RKGY. It is sometimes possible for the material contained within the vial of "Cytochrome c oxidase assembly factor 5 (COA5), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
