Cytochrome oxidase assembly protein 3, mitochondrial (COA3) Recombinant Protein | ZYRO0G20790g recombinant protein
Recombinant Zygosaccharomyces rouxii Cytochrome oxidase assembly protein 3, mitochondrial (COA3)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cytochrome oxidase assembly protein 3; mitochondrial (COA3); Recombinant Zygosaccharomyces rouxii Cytochrome oxidase assembly protein 3; ZYRO0G20790g recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-87
Sequence
MVLDPSRYQDHRTWKMTPGLIRARQPFFKKNMIGLAILAGVSAGIYTYTYSFLHKDNDFADVPIPPIDEKELEKLKKEYEQHKQERQ
Sequence Length
87
Species
Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) (Candida mogii)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Related Product Information for ZYRO0G20790g recombinant protein
COA3
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10,283 Da
NCBI Official Full Name
ZYRO0G20790p
NCBI Official Symbol
ZYRO0G20790g
NCBI Protein Information
hypothetical protein
UniProt Protein Name
Cytochrome oxidase assembly protein 3, mitochondrial
UniProt Gene Name
COA3
UniProt Entry Name
COA3_ZYGRC
Uniprot Description
Function: Required for assembly of cytochrome c oxidase (complex IV)
By similarity.
Subunit structure: Component of 250-400 kDa complexes called cytochrome oxidase assembly intermediates or COA complexes
By similarity.
Subcellular location: Mitochondrion inner membrane; Single-pass membrane protein.
Sequence similarities: Belongs to the COA3 family.
Similar Products
Product Notes
The ZYRO0G20790g coa3 (Catalog #AAA1051497) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-87. The amino acid sequence is listed below: MVLDPSRYQD HRTWKMTPGL IRARQPFFKK NMIGLAILAG VSAGIYTYTY SFLHKDNDFA DVPIPPIDEK ELEKLKKEYE QHKQERQ. It is sometimes possible for the material contained within the vial of "Cytochrome oxidase assembly protein 3, mitochondrial (COA3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
