Ciliary neurotrophic factor receptor subunit alpha (CNTFR) Recombinant Protein | CNTFR recombinant protein
Recombinant Chicken Ciliary neurotrophic factor receptor subunit alpha (CNTFR)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ciliary neurotrophic factor receptor subunit alpha (CNTFR); Recombinant Chicken Ciliary neurotrophic factor receptor subunit alpha (CNTFR); CNTFR recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
20-334, Full length protein
Sequence
YAQRHSQQDSHIQYERVGADVTMKCGSMDWDAAVTWTANGTDIDDSHLNGSYLILKNVDLTQSGQYSCYEGSSWHLKYQTYLRVGVPPKEPVLMCRSNNYPKGFYCSWHLPSPTYIPNSFNISVIHGTREMVCEKDIFPKNRCHIRYLQLFSTVKYKVTLTVTNALGKNSTTLTFDEFAIVKPDPPESVVAKPVPNNPRRLEVSWQNPSSWPDPESFPLKFFLRYRPLILDQWQHVELSDGTSHTITDAYAGKEYIIQVAAKDNDIGTWSDWSVAVHATPWTEEPKHLTTEVQITETTSTSTSSFMPPPTTKICD
Sequence Length
315
Species
Chicken
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for CNTFR recombinant protein
This gene encodes a hematopoeitin
interferon-class receptor belonging to the cytokine superfamily of receptors. The encoded gene product represents the CNTF-specific alpha subunit of a heterotrimer forming the CNTF receptor complex, which also includes LIFR and gp130. The receptor is attached to the membrane by a glycosyl-phosphatidylinositol linkage and contains an immunoglobulin-like C2-type domain and a fibronectin type-III domain. Signal transduction requires that CNTF bind first to this alpha component, which permits the recruitment of gp130 and LIFR beta to form the tripartite receptor complex. Signal transduction stimulates gene expression, cell survival or differentiation in a variety of neuronal cell types. Alternative splicing has been observed at this locus and two variants, both encoding the same protein, have been identified.
interferon-class receptor belonging to the cytokine superfamily of receptors. The encoded gene product represents the CNTF-specific alpha subunit of a heterotrimer forming the CNTF receptor complex, which also includes LIFR and gp130. The receptor is attached to the membrane by a glycosyl-phosphatidylinositol linkage and contains an immunoglobulin-like C2-type domain and a fibronectin type-III domain. Signal transduction requires that CNTF bind first to this alpha component, which permits the recruitment of gp130 and LIFR beta to form the tripartite receptor complex. Signal transduction stimulates gene expression, cell survival or differentiation in a variety of neuronal cell types. Alternative splicing has been observed at this locus and two variants, both encoding the same protein, have been identified.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,308 Da
NCBI Official Full Name
ciliary neurotrophic factor receptor subunit alpha
NCBI Official Synonym Full Names
ciliary neurotrophic factor receptor
NCBI Official Symbol
CNTFR
NCBI Protein Information
ciliary neurotrophic factor receptor subunit alpha
UniProt Protein Name
Ciliary neurotrophic factor receptor subunit alpha
Protein Family
UniProt Gene Name
CNTFR
UniProt Synonym Gene Names
CNTF receptor subunit alpha; CNTFR-alpha; GPA receptor subunit alpha; GPAR-alpha
Uniprot Description
Binds to CNTF (GPA). The alpha subunit provides the receptor specificity.
Similar Products
Product Notes
The CNTFR cntfr (Catalog #AAA950400) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-334, Full length protein. The amino acid sequence is listed below: YAQRHSQQDS HIQYERVGAD VTMKCGSMDW DAAVTWTANG TDIDDSHLNG SYLILKNVDL TQSGQYSCYE GSSWHLKYQT YLRVGVPPKE PVLMCRSNNY PKGFYCSWHL PSPTYIPNSF NISVIHGTRE MVCEKDIFPK NRCHIRYLQL FSTVKYKVTL TVTNALGKNS TTLTFDEFAI VKPDPPESVV AKPVPNNPRR LEVSWQNPSS WPDPESFPLK FFLRYRPLIL DQWQHVELSD GTSHTITDAY AGKEYIIQVA AKDNDIGTWS DWSVAVHATP WTEEPKHLTT EVQITETTST STSSFMPPPT TKICD. It is sometimes possible for the material contained within the vial of "Ciliary neurotrophic factor receptor subunit alpha (CNTFR), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
